• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • PPI
    • iRefIndex
    • PINA
    • HINT
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Atr-002644
Ensembl Protein ID ERN17375
UniProt Accession U5D564; U5D564_AMBTC
Genbank Protein ID ERN17375.1
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Genbank Nucleotide ID KI392350
Gene Name AMTR_s00037p00181430
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AMTR_s00037p00181430 ERN17375 ERN17375
Status Unreviewed
Classification
Family E-Value Score Start End
E1 6.90e-109 365.2 8 514
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvnveaheesitele 101
    YDRQ+r+wGe++qe+l++a+++l+++g++G+E+lKnLvl+G+gsitv+D+++ve +++++F+++ +++ +sKA++++++l+eln++v+++++ees+++l
   Q: 8 YDRQLRIWGEQGQEALEKASICLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEEGDMGNNFMVDLQSIAQSKAKCVCAFLQELNDSVRAKFVEESPEALI 108
    ***************************************************************************************************** PP
   S: 102 eeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfctlketpn.........aaehtiew 189
    ++++ Ff++f++V++++ + + +k++++c+++++ li ++++Gl G vr++ik++ + + ++d d++++++P+++lk++ + ++++++++
   Q: 109 DTNPaFFQQFTLVIATQLLENSILKLDKICRQYNIMLIVARSYGLTGLVRISIKEHDVVDTKPDhflDDLRLNNPWPELKQFAEsidlyttdpVVHKHTPY 209
    **********************************************************************************99999999999******** PP
   S: 190 avlfnklleeeageeevlekldseekeegkdkvkselksedeenfeeaieiavkafakttins.ikqllksfecdivtkskspfwv............... 274
    +v++ k++ee+a+++ ++ ++++eek+e+k++ ks++ s de+n++ea+e+++k ++ i+ q+ ++ + +i +s+ +fwv
   Q: 210 VVILVKIVEEWASAHGGKFPSTREEKREFKELLKSKMISLDEDNYKEAMEASFKVSLPCGISPqLHQIVNDSSVEI-DSSSYNFWVlvaalkefieneggg 309
    ***************************************************************9*******77755.9*********************** PP
   S: 275 ............................................................sfcsnaealq...........vpekvekdeevvkasap... 301
    +fc+na++l + ++ +++++++++
   Q: 310 epplegsipdmtslteyyislqkiyqskadadflaieqhvkgilkrigrdpdtilkttikNFCKNARKLMvcryrliedefNSPILTEVQKYLTDEDYsva 410
    **********************************************************************6666665555433777778888888888999 PP
   S: 302 ..lylllralerfekkkgrkpgelsfekdddsavdlvtaaanlraeslgiep.kldddlikeiagniipaiattnavvgGlaaqEviKvvsgkfeplknff 399
    +y+llra++rf ++++r pg ++ e+d+d +l+t +a+ + ++g+++ l++dli+e+++++ ++++t++a++gG+a+qE+iK+++++f pl +f
   Q: 411 vgFYVLLRAVDRFTSNYNRFPGLFDGEMDED-TSRLKT-IAVGILNDMGCNGsSLSEDLISEMCRYGGAELHTVAAYIGGIASQEAIKLITKQFIPLTGTF 509
    99*****************************.888888.445566******************************************************** PP
   S: 400 lfdae 404
    +f+++
   Q: 510 IFNGI 514
    **986 PP
   

Organism Amborella trichopoda
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Protein Sequence
(Fasta)
MAEPKSKYDR QLRIWGEQGQ EALEKASICL LNCGPTGSET LKNLVLGGIG SITVIDGSKV 60
EEGDMGNNFM VDLQSIAQSK AKCVCAFLQE LNDSVRAKFV EESPEALIDT NPAFFQQFTL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Atr-002644|E1,E1_ThiF|Amborella trichopoda
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGCGGAAC CGAAGAGCAA ATACGATCGT CAGCTCAGGT TCGCCTCCCC TCCCTCTTAC 60
TTTTTTTACT GAGTCATTCT CTATGCGCAC TATCACTAAC CAAGCATGTC GCTTCCCTTT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Atr-002644|E1,E1_ThiF|Amborella trichopoda
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

KEGG atr:18445714
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 69.20 0.00e+00 776.00
IUUC-Aml-002333 Ailuropoda melanoleuca 41.39 2.00e-123 435.00
IUUC-Apl-003446 Anas platyrhynchos 40.04 7.00e-113 399.00
IUUC-Aca-004450 Anolis carolinensis 39.58 7.00e-120 423.00
IUUC-Aly-005466 Arabidopsis lyrata 70.61 0.00e+00 811.00
IUUC-Ath-006692 Arabidopsis thaliana 71.56 0.00e+00 822.00
IUUC-Ago-007900 Ashbya gossypii 25.83 3.00e-35 141.00
IUUC-Acl-008333 Aspergillus clavatus 32.35 2.00e-68 252.00
IUUC-Afl-008529 Aspergillus flavus 33.45 3.00e-76 278.00
IUUC-Afu-009071 Aspergillus fumigatus 32.97 3.00e-70 258.00
IUUC-Ani-009443 Aspergillus nidulans 30.52 6.00e-63 234.00
IUUC-Ang-009669 Aspergillus niger 31.94 5.00e-72 264.00
IUUC-Aor-009914 Aspergillus oryzae 33.15 2.00e-74 271.00
IUUC-Ate-010450 Aspergillus terreus 33.52 3.00e-73 268.00
IUUC-Ame-011183 Astyanax mexicanus 38.79 4.00e-119 420.00
IUUC-Bgr-012111 Blumeria graminis 32.34 2.00e-63 235.00
IUUC-Bta-012583 Bos taurus 40.94 6.00e-124 436.00
IUUC-Bci-013892 Botrytis cinerea 31.23 2.00e-55 208.00
IUUC-Bdi-014592 Brachypodium distachyon 68.71 0.00e+00 771.00
IUUC-Bol-016399 Brassica oleracea 71.32 0.00e+00 817.00
IUUC-Bra-017506 Brassica rapa 69.33 0.00e+00 788.00
IUUC-Cel-018456 Caenorhabditis elegans 30.91 2.00e-71 261.00
IUUC-Cja-020007 Callithrix jacchus 40.93 7.00e-123 432.00
IUUC-Cfa-020324 Canis familiaris 41.54 5.00e-125 440.00
IUUC-Cpo-022248 Cavia porcellus 36.13 1.00e-64 239.00
IUUC-Csa-023149 Chlorocebus sabaeus 38.17 2.00e-95 341.00
IUUC-Cho-024537 Choloepus hoffmanni 34.35 2.00e-82 298.00
IUUC-Cin-025763 Ciona intestinalis 40.04 4.00e-111 394.00
IUUC-Csv-026113 Ciona savignyi 39.59 1.00e-105 375.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 30.04 9.00e-56 210.00
IUUC-Cne-026884 Cryptococcus neoformans 33.65 1.00e-72 266.00
IUUC-Cme-027210 Cyanidioschyzon merolae 22.59 1.00e-13 70.50
IUUC-Dre-028140 Danio rerio 40.30 7.00e-124 436.00
IUUC-Dno-030033 Dasypus novemcinctus 40.91 4.00e-106 377.00
IUUC-Dor-030513 Dipodomys ordii 51.82 2.00e-26 112.00
IUUC-Dse-031536 Dothistroma septosporum 32.43 7.00e-71 260.00
IUUC-Dme-031683 Drosophila melanogaster 38.39 4.00e-95 340.00
IUUC-Ete-032420 Echinops telfairi 37.96 5.00e-109 386.00
IUUC-Eca-033992 Equus caballus 38.95 2.00e-95 341.00
IUUC-Eeu-034713 Erinaceus europaeus 31.67 3.00e-34 138.00
IUUC-Fca-036548 Felis catus 40.90 3.00e-124 437.00
IUUC-Fal-037600 Ficedula albicollis 39.39 6.00e-114 403.00
IUUC-Fox-038037 Fusarium oxysporum 31.39 1.00e-63 236.00
IUUC-Fso-038387 Fusarium solani 32.19 7.00e-64 236.00
IUUC-Gmo-038562 Gadus morhua 39.05 4.00e-116 410.00
IUUC-Ggr-040005 Gaeumannomyces graminis 35.20 1.00e-55 209.00
IUUC-Gga-041129 Gallus gallus 40.15 7.00e-116 409.00
IUUC-Gac-042558 Gasterosteus aculeatus 39.77 5.00e-119 420.00
IUUC-Gma-043610 Glycine max 74.00 0.00e+00 822.00
IUUC-Ggo-045611 Gorilla gorilla 41.03 7.00e-122 429.00
IUUC-Hsa-046563 Homo sapiens 41.27 5.00e-123 433.00
IUUC-Hvu-047790 Hordeum vulgare 68.38 3.00e-162 563.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 40.94 1.00e-123 435.00
IUUC-Kpa-049309 Komagataella pastoris 35.65 1.00e-78 286.00
IUUC-Lch-050038 Latimeria chalumnae 39.59 7.00e-117 413.00
IUUC-Lpe-051535 Leersia perrieri 68.62 0.00e+00 701.00
IUUC-Loc-051917 Lepisosteus oculatus 38.10 4.00e-109 387.00
IUUC-Lma-053112 Leptosphaeria maculans 33.51 2.00e-75 275.00
IUUC-Laf-053690 Loxodonta africana 41.89 3.00e-125 441.00
IUUC-Mcc-055117 Macaca mulatta 40.26 1.00e-120 426.00
IUUC-Meu-056761 Macropus eugenii 33.58 6.00e-87 313.00
IUUC-Mor-057230 Magnaporthe oryzae 32.42 7.00e-64 236.00
IUUC-Mpo-057514 Magnaporthe poae 32.18 7.00e-63 233.00
IUUC-Mtr-058551 Medicago truncatula 69.94 0.00e+00 771.00
IUUC-Mla-059183 Melampsora laricipopulina 33.83 2.00e-85 308.00
IUUC-Mga-060144 Meleagris gallopavo 39.58 6.00e-113 399.00
IUUC-Mvi-060221 Microbotryum violaceum 33.40 6.00e-72 263.00
IUUC-Mmr-061325 Microcebus murinus 39.59 6.00e-120 423.00
IUUC-Mdo-062532 Monodelphis domestica 41.14 4.00e-122 430.00
IUUC-Mmu-063956 Mus musculus 40.75 4.00e-124 437.00
IUUC-Mac-064521 Musa acuminata 71.68 0.00e+00 810.00
IUUC-Mpu-066716 Mustela putorius furo 40.95 6.00e-116 410.00
IUUC-Mlu-067459 Myotis lucifugus 41.71 1.00e-125 442.00
IUUC-Nfi-068245 Neosartorya fischeri 32.48 2.00e-69 255.00
IUUC-Ncr-068910 Neurospora crassa 31.56 5.00e-65 240.00
IUUC-Nle-070034 Nomascus leucogenys 40.00 1.00e-118 418.00
IUUC-Opr-070552 Ochotona princeps 37.70 3.00e-96 344.00
IUUC-Ont-071426 Oreochromis niloticus 39.36 1.00e-121 428.00
IUUC-Oan-073389 Ornithorhynchus anatinus 39.46 3.00e-87 314.00
IUUC-Ocu-074911 Oryctolagus cuniculus 41.70 8.00e-126 442.00
IUUC-Oba-075437 Oryza barthii 71.98 0.00e+00 767.00
IUUC-Obr-076684 Oryza brachyantha 71.10 0.00e+00 725.00
IUUC-Ogl-077170 Oryza glaberrima 71.98 0.00e+00 767.00
IUUC-Ogu-078844 Oryza glumaepatula 70.62 0.00e+00 712.00
IUUC-Oin-079105 Oryza indica 71.79 0.00e+00 763.00
IUUC-Olo-080943 Oryza longistaminata 68.83 0.00e+00 689.00
IUUC-Oni-082891 Oryza nivara 69.48 0.00e+00 734.00
IUUC-Opu-083457 Oryza punctata 71.40 0.00e+00 758.00
IUUC-Oru-084960 Oryza rufipogon 68.75 0.00e+00 691.00
IUUC-Osa-085358 Oryza sativa 71.59 0.00e+00 760.00
IUUC-Ola-086420 Oryzias latipes 36.39 8.00e-75 272.00
IUUC-Olu-087625 Ostreococcus lucimarinus 29.07 5.00e-62 230.00
IUUC-Oga-088810 Otolemur garnettii 41.73 6.00e-125 439.00
IUUC-Oar-089196 Ovis aries 40.71 2.00e-122 431.00
IUUC-Ptr-090617 Pan troglodytes 41.27 2.00e-123 434.00
IUUC-Pan-092761 Papio anubis 41.32 9.00e-125 439.00
IUUC-Psi-093191 Pelodiscus sinensis 39.03 2.00e-115 407.00
IUUC-Pma-094380 Petromyzon marinus 39.72 6.00e-108 383.00
IUUC-Pno-095084 Phaeosphaeria nodorum 31.08 6.00e-60 225.00
IUUC-Ppa-095798 Physcomitrella patens 55.85 0.00e+00 646.00
IUUC-Pfo-096467 Poecilia formosa 38.97 6.00e-116 409.00
IUUC-Pab-098255 Pongo abelii 41.22 2.00e-102 364.00
IUUC-Pop-099722 Populus trichocarpa 76.67 0.00e+00 867.00
IUUC-Pca-100807 Procavia capensis 50.00 1.00e-51 196.00
IUUC-Ppe-101280 Prunus persica 77.06 0.00e+00 872.00
IUUC-Pva-102333 Pteropus vampyrus 40.19 6.00e-117 413.00
IUUC-Pgr-103401 Puccinia graminis 29.40 4.00e-73 268.00
IUUC-Ptt-103889 Puccinia triticina 28.40 8.00e-62 230.00
IUUC-Pte-104355 Pyrenophora teres 33.75 5.00e-72 264.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 35.01 9.00e-73 266.00
IUUC-Rno-105810 Rattus norvegicus 41.07 3.00e-123 434.00
IUUC-Sce-106397 Saccharomyces cerevisiae 26.04 9.00e-32 130.00
IUUC-Sha-106770 Sarcophilus harrisii 45.96 8.00e-70 255.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 32.25 5.00e-77 280.00
IUUC-Spo-108276 Schizosaccharomyces pombe 31.84 1.00e-79 288.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 31.45 1.00e-56 212.00
IUUC-Smo-109296 Selaginella moellendorffii 52.88 4.00e-168 583.00
IUUC-Sit-110157 Setaria italica 69.98 0.00e+00 804.00
IUUC-Sly-111105 Solanum lycopersicum 71.88 0.00e+00 832.00
IUUC-Stu-112469 Solanum tuberosum 72.63 0.00e+00 842.00
IUUC-Sar-113083 Sorex araneus 33.20 7.00e-84 303.00
IUUC-Sbi-113813 Sorghum bicolor 69.02 0.00e+00 799.00
IUUC-Sre-115058 Sporisorium reilianum 33.33 2.00e-62 232.00
IUUC-Tgu-116772 Taeniopygia guttata 40.61 1.00e-115 409.00
IUUC-Tru-118686 Takifugu rubripes 37.83 5.00e-118 417.00
IUUC-Tsy-119111 Tarsius syrichta 43.96 1.00e-62 232.00
IUUC-Tni-120231 Tetraodon nigroviridis 36.79 4.00e-104 370.00
IUUC-Tca-121491 Theobroma cacao 75.91 0.00e+00 822.00
IUUC-Tre-122103 Trichoderma reesei 31.55 7.00e-70 256.00
IUUC-Tvi-122672 Trichoderma virens 32.59 6.00e-67 247.00
IUUC-Tae-125316 Triticum aestivum 70.06 0.00e+00 783.00
IUUC-Tur-126487 Triticum urartu 68.67 0.00e+00 754.00
IUUC-Tme-127097 Tuber melanosporum 33.77 2.00e-74 271.00
IUUC-Ttr-128465 Tursiops truncatus 38.84 1.00e-110 392.00
IUUC-Uma-129645 Ustilago maydis 29.30 2.00e-67 249.00
IUUC-Vda-129989 Verticillium dahliae 27.62 2.00e-46 179.00
IUUC-Vpa-130529 Vicugna pacos 39.21 3.00e-113 400.00
IUUC-Vvi-131059 Vitis vinifera 78.59 0.00e+00 867.00
IUUC-Xtr-132002 Xenopus tropicalis 40.85 1.00e-122 432.00
IUUC-Xma-133930 Xiphophorus maculatus 39.46 1.00e-120 425.00
IUUC-Yli-134505 Yarrowia lipolytica 32.25 9.00e-80 289.00
IUUC-Zma-135895 Zea mays 68.33 0.00e+00 790.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved