• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • PPI
    • iRefIndex
    • PINA
    • HINT
  • 3D Structure
    • PDB
    • MMDB
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Vda-129711
Ensembl Protein ID EGY18863
UniProt Accession G2XG44; G2XG44_VERDV
Genbank Protein ID EGY18863.1
Protein Name Ubiquitin-conjugating enzyme
Genbank Nucleotide ID DS572718
Gene Name VDAG_09023
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
VDAG_09023 EGY18863 EGY18863
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.40e-52 176.3 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++dpp+g+sa+pv + ++++w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ v
   Q: 8 RLMRDFKRMQTDPPAGVSASPVPD-NVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPAVKFISQMFHPNVYATGELCLDILQ--NRWSPTYDVAAV 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvre 139
    l+siqsll++pn+ sp+n+ea++l+k+nr+ey k+vre
   Q: 106 LTSIQSLLNDPNTGSPANVEASNLYKDNRKEYTKRVRE 143
    ***********************************985 PP
   

Organism Verticillium dahliae
Protein Sequence
(Fasta)
MSTAARRRLM RDFKRMQTDP PAGVSASPVP DNVMTWNAVI IGPADTPFED GTFRLVMQFE 60
EQYPNKPPAV KFISQMFHPN VYATGELCLD ILQNRWSPTY DVAAVLTSIQ SLLNDPNTGS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Vda-129711|E2,E2/UBC|Verticillium dahliae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ACCTTGTCCT GTCTTCAGCT CAGGCTTCCT TTCCTTCAAC CTTCTGCCAA ACCCACCTGA 60
CAAATCTACT TCGTTTCGCC CCTGCAATCC ACCCCCGACG AACCTCATGC GACCCGACTA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Vda-129711|E2,E2/UBC|Verticillium dahliae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG vda:VDAG_09023
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 65.10 3.00e-61 224.00
IUUC-Aml-002120 Ailuropoda melanoleuca 68.87 9.00e-65 236.00
IUUC-Atr-002623 Amborella trichopoda 67.11 3.00e-62 228.00
IUUC-Apl-004063 Anas platyrhynchos 61.49 3.00e-54 202.00
IUUC-Aca-005001 Anolis carolinensis 68.21 1.00e-64 236.00
IUUC-Aly-005584 Arabidopsis lyrata 66.44 8.00e-62 227.00
IUUC-Ath-007149 Arabidopsis thaliana 66.44 8.00e-62 227.00
IUUC-Ago-007745 Ashbya gossypii 77.33 7.00e-72 260.00
IUUC-Acl-008139 Aspergillus clavatus 94.04 3.00e-84 301.00
IUUC-Afl-008551 Aspergillus flavus 94.70 1.00e-84 302.00
IUUC-Afu-008980 Aspergillus fumigatus 94.70 1.00e-84 302.00
IUUC-Ang-009554 Aspergillus niger 94.70 1.00e-84 302.00
IUUC-Aor-010242 Aspergillus oryzae 94.70 1.00e-84 302.00
IUUC-Ate-010390 Aspergillus terreus 94.70 1.00e-84 302.00
IUUC-Ame-010743 Astyanax mexicanus 69.54 7.00e-65 237.00
IUUC-Bgr-012039 Blumeria graminis 95.59 2.00e-76 275.00
IUUC-Bta-012840 Bos taurus 68.87 9.00e-65 236.00
IUUC-Bci-013919 Botrytis cinerea 97.35 3.00e-86 308.00
IUUC-Bdi-015010 Brachypodium distachyon 67.11 5.00e-62 227.00
IUUC-Bol-015726 Brassica oleracea 66.44 3.00e-61 228.00
IUUC-Bra-016809 Brassica rapa 66.44 7.00e-62 228.00
IUUC-Cel-018244 Caenorhabditis elegans 69.80 3.00e-65 239.00
IUUC-Cja-018783 Callithrix jacchus 68.87 1.00e-64 236.00
IUUC-Cfa-020244 Canis familiaris 68.87 9.00e-65 236.00
IUUC-Cpo-021323 Cavia porcellus 69.54 6.00e-65 237.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 68.22 7.00e-53 197.00
IUUC-Csa-023588 Chlorocebus sabaeus 68.87 1.00e-64 236.00
IUUC-Cho-024773 Choloepus hoffmanni 54.30 9.00e-45 170.00
IUUC-Cin-025537 Ciona intestinalis 68.46 3.00e-54 201.00
IUUC-Csv-025846 Ciona savignyi 68.46 8.00e-58 213.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 100.00 1.00e-88 316.00
IUUC-Cne-026864 Cryptococcus neoformans 71.81 2.00e-66 242.00
IUUC-Cme-027284 Cyanidioschyzon merolae 63.33 1.00e-50 191.00
IUUC-Dre-027775 Danio rerio 68.87 6.00e-65 237.00
IUUC-Dno-029661 Dasypus novemcinctus 68.87 9.00e-65 236.00
IUUC-Dor-030452 Dipodomys ordii 66.18 2.00e-56 208.00
IUUC-Dse-031487 Dothistroma septosporum 94.70 3.00e-85 304.00
IUUC-Dme-031863 Drosophila melanogaster 70.20 1.00e-64 236.00
IUUC-Ete-032595 Echinops telfairi 66.89 4.00e-63 231.00
IUUC-Eca-033377 Equus caballus 68.87 9.00e-65 236.00
IUUC-Eeu-035191 Erinaceus europaeus 54.90 2.00e-44 169.00
IUUC-Fca-036581 Felis catus 68.87 1.00e-64 236.00
IUUC-Fal-037474 Ficedula albicollis 67.80 1.00e-49 186.00
IUUC-Fox-037808 Fusarium oxysporum 99.34 5.00e-88 314.00
IUUC-Fso-038232 Fusarium solani 98.68 1.00e-87 312.00
IUUC-Gmo-038517 Gadus morhua 68.87 1.00e-64 236.00
IUUC-Ggr-039875 Gaeumannomyces graminis 98.00 3.00e-86 308.00
IUUC-Gga-040588 Gallus gallus 68.87 1.00e-64 236.00
IUUC-Gac-042471 Gasterosteus aculeatus 68.87 4.00e-65 238.00
IUUC-Gma-043688 Glycine max 67.79 9.00e-63 230.00
IUUC-Ggo-044896 Gorilla gorilla 68.87 1.00e-64 236.00
IUUC-Hsa-046383 Homo sapiens 68.87 1.00e-64 236.00
IUUC-Hvu-047054 Hordeum vulgare 65.10 3.00e-61 224.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 68.87 1.00e-64 236.00
IUUC-Kpa-049225 Komagataella pastoris 82.55 2.00e-75 272.00
IUUC-Lch-049964 Latimeria chalumnae 68.87 1.00e-64 236.00
IUUC-Lpe-051301 Leersia perrieri 67.11 3.00e-62 228.00
IUUC-Loc-051962 Lepisosteus oculatus 70.20 2.00e-65 239.00
IUUC-Laf-053680 Loxodonta africana 68.87 1.00e-64 236.00
IUUC-Mcc-054819 Macaca mulatta 68.87 6.00e-65 237.00
IUUC-Meu-056231 Macropus eugenii 68.87 1.00e-64 236.00
IUUC-Mor-057087 Magnaporthe oryzae 96.30 1.00e-76 276.00
IUUC-Mpo-057498 Magnaporthe poae 98.00 1.00e-86 310.00
IUUC-Mtr-058305 Medicago truncatula 67.11 2.00e-62 229.00
IUUC-Mla-058876 Melampsora laricipopulina 75.50 9.00e-65 237.00
IUUC-Mga-059863 Meleagris gallopavo 65.47 4.00e-57 211.00
IUUC-Mvi-060330 Microbotryum violaceum 74.83 5.00e-62 227.00
IUUC-Mmr-060630 Microcebus murinus 68.87 9.00e-65 236.00
IUUC-Mdo-062292 Monodelphis domestica 68.87 1.00e-64 236.00
IUUC-Mmu-063680 Mus musculus 68.87 1.00e-64 236.00
IUUC-Mac-064774 Musa acuminata 67.11 4.00e-62 228.00
IUUC-Mpu-065803 Mustela putorius furo 68.87 9.00e-65 236.00
IUUC-Mlu-067147 Myotis lucifugus 68.87 9.00e-65 236.00
IUUC-Nfi-068580 Neosartorya fischeri 94.70 1.00e-84 302.00
IUUC-Ncr-068913 Neurospora crassa 97.35 1.00e-86 309.00
IUUC-Nle-069121 Nomascus leucogenys 68.87 1.00e-64 236.00
IUUC-Opr-070935 Ochotona princeps 68.87 9.00e-65 236.00
IUUC-Ont-071335 Oreochromis niloticus 68.87 4.00e-65 238.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.70 8.00e-58 213.00
IUUC-Ocu-074130 Oryctolagus cuniculus 68.87 9.00e-65 236.00
IUUC-Oba-075896 Oryza barthii 67.11 3.00e-62 228.00
IUUC-Obr-076770 Oryza brachyantha 67.79 1.00e-62 229.00
IUUC-Ogl-077116 Oryza glaberrima 67.11 3.00e-62 228.00
IUUC-Ogu-078696 Oryza glumaepatula 67.11 3.00e-62 228.00
IUUC-Oin-079099 Oryza indica 67.11 3.00e-62 228.00
IUUC-Olo-081018 Oryza longistaminata 56.36 3.00e-52 196.00
IUUC-Ome-081285 Oryza meridionalis 67.11 3.00e-62 228.00
IUUC-Oni-082088 Oryza nivara 67.11 3.00e-62 228.00
IUUC-Opu-083310 Oryza punctata 67.11 3.00e-62 228.00
IUUC-Oru-084449 Oryza rufipogon 67.11 3.00e-62 228.00
IUUC-Osa-085923 Oryza sativa 67.11 3.00e-62 228.00
IUUC-Ola-087160 Oryzias latipes 68.87 4.00e-65 238.00
IUUC-Olu-087830 Ostreococcus lucimarinus 65.77 6.00e-54 201.00
IUUC-Oga-088659 Otolemur garnettii 68.87 1.00e-64 236.00
IUUC-Oar-090141 Ovis aries 68.87 9.00e-65 236.00
IUUC-Ptr-091305 Pan troglodytes 68.87 1.00e-64 236.00
IUUC-Pan-092511 Papio anubis 68.87 9.00e-65 236.00
IUUC-Psi-094094 Pelodiscus sinensis 68.87 1.00e-64 236.00
IUUC-Pma-094376 Petromyzon marinus 68.87 3.00e-64 235.00
IUUC-Pno-094935 Phaeosphaeria nodorum 93.38 2.00e-83 298.00
IUUC-Ppa-095689 Physcomitrella patens 69.29 2.00e-53 199.00
IUUC-Pfo-096656 Poecilia formosa 68.21 1.00e-64 236.00
IUUC-Pab-097972 Pongo abelii 68.87 1.00e-64 236.00
IUUC-Pop-099517 Populus trichocarpa 67.11 2.00e-62 228.00
IUUC-Pca-100906 Procavia capensis 63.58 5.00e-58 214.00
IUUC-Ppe-101594 Prunus persica 67.11 3.00e-62 228.00
IUUC-Pva-102380 Pteropus vampyrus 68.21 2.00e-62 229.00
IUUC-Pgr-103611 Puccinia graminis 75.50 6.00e-65 237.00
IUUC-Ptt-103971 Puccinia triticina 77.97 2.00e-49 185.00
IUUC-Pte-104378 Pyrenophora teres 93.38 5.00e-84 300.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 93.38 5.00e-84 300.00
IUUC-Rno-105772 Rattus norvegicus 68.87 6.00e-65 237.00
IUUC-Sce-106283 Saccharomyces cerevisiae 77.33 6.00e-72 261.00
IUUC-Sha-107650 Sarcophilus harrisii 68.21 2.00e-63 232.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 82.67 3.00e-67 244.00
IUUC-Spo-108073 Schizosaccharomyces pombe 82.67 3.00e-67 245.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 97.35 3.00e-86 308.00
IUUC-Smo-109036 Selaginella moellendorffii 67.11 2.00e-62 229.00
IUUC-Sit-110731 Setaria italica 67.11 3.00e-62 228.00
IUUC-Sly-111506 Solanum lycopersicum 67.11 2.00e-62 229.00
IUUC-Stu-112080 Solanum tuberosum 67.11 2.00e-62 229.00
IUUC-Sar-113429 Sorex araneus 68.87 9.00e-65 236.00
IUUC-Sbi-114289 Sorghum bicolor 67.11 3.00e-62 228.00
IUUC-Sre-115106 Sporisorium reilianum 72.85 3.00e-62 228.00
IUUC-Ssc-116265 Sus scrofa 68.87 1.00e-64 236.00
IUUC-Tgu-117383 Taeniopygia guttata 68.87 1.00e-64 236.00
IUUC-Tru-118576 Takifugu rubripes 68.21 4.00e-64 234.00
IUUC-Tsy-119000 Tarsius syrichta 68.87 9.00e-65 236.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.21 2.00e-64 235.00
IUUC-Tca-121827 Theobroma cacao 67.79 1.00e-62 229.00
IUUC-Tre-122002 Trichoderma reesei 98.01 2.00e-87 312.00
IUUC-Tvi-122331 Trichoderma virens 98.01 2.00e-87 312.00
IUUC-Tae-124461 Triticum aestivum 66.44 9.00e-62 228.00
IUUC-Tur-126866 Triticum urartu 65.77 1.00e-61 226.00
IUUC-Tme-127148 Tuber melanosporum 92.67 3.00e-83 298.00
IUUC-Tbe-127921 Tupaia belangeri 66.89 2.00e-60 222.00
IUUC-Ttr-129121 Tursiops truncatus 68.87 9.00e-65 236.00
IUUC-Uma-129561 Ustilago maydis 72.85 3.00e-62 229.00
IUUC-Vpa-130570 Vicugna pacos 61.03 1.00e-50 189.00
IUUC-Vvi-131108 Vitis vinifera 67.11 9.00e-63 230.00
IUUC-Xtr-131824 Xenopus tropicalis 68.87 7.00e-65 237.00
IUUC-Xma-133667 Xiphophorus maculatus 68.87 4.00e-65 238.00
IUUC-Yli-134660 Yarrowia lipolytica 84.77 8.00e-78 280.00
IUUC-Zma-135584 Zea mays 65.77 1.00e-61 226.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved