• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
iUUCD ID IUUC-Uma-129435
Ensembl Protein ID KIS66579
UniProt Accession Q4P2U6; A0A0D1DQB5; ATG8_USTMA
Genbank Protein ID KIS66579.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier atg8
Genbank Nucleotide ID CM003157
Gene Name ATG8; UMAG_05567
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
UMAG_05567 KIS66579 KIS66579
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 1.20e-48 162.0 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayasee 101
    krk+e+e+ir+k+pd+iPvi+eka++++ip++dkkkylvPsdltvgq+v++irkr++l +e+a+f++v+++l++++a +++iyee+kdedgflyv+y++e+
   Q: 13 KRKAEAERIRQKYPDRIPVICEKADRTDIPTIDKKKYLVPSDLTVGQFVYVIRKRIKLAPEKAIFIFVDEVLPATAALMSAIYEEHKDEDGFLYVSYSGEN 113
    699************************************************************************************************** PP
   S: 102 tfG 104
    tfG
   Q: 114 TFG 116
    **9 PP
   

Organism Ustilago maydis
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Required for selective autophagic degradation of the mitochondria (mitophagy) which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Required for wild-type budding of haploid sporidia and for complete symptom development during pathogenic growth such as gall formation and teliospore production in ears of mature maize (PubMed:20618705, PubMed:22843561).
Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Required for selective autophagic degradation of the mitochondria (mitophagy) which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Required for wild-type budding of haploid sporidia and for complete symptom development during pathogenic growth such as gall formation and teliospore production in ears of mature maize (PubMed:20618705, PubMed:22843561).
Protein Sequence
(Fasta)
MRSAFKNEHS FEKRKAEAER IRQKYPDRIP VICEKADRTD IPTIDKKKYL VPSDLTVGQF 60
VYVIRKRIKL APEKAIFIFV DEVLPATAAL MSAIYEEHKD EDGFLYVSYS GENTFGQL 118
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Uma-129435|ULD,ATG8|Ustilago maydis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCGTTCCG CATTCAAGAA CGAGCACTCT TTTGAGAAGC GCAAGGCTGA GGCCGAGAGG 60
ATCCGTCAGA AGTACCCGGA CCGCATCCCT GTCATCTGCG AAAAGGCTGA CCGCACCGAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Uma-129435|ULD,ATG8|Ustilago maydis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole
KW-0843--Virulence

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0009405--P:pathogenesis
GO:0015031--P:protein transport

KEGG uma:UMAG_05567
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 74.14 9.00e-51 189.00
IUUC-Aml-001629 Ailuropoda melanoleuca 60.34 4.00e-40 154.00
IUUC-Atr-002791 Amborella trichopoda 80.34 5.00e-53 197.00
IUUC-Apl-003994 Anas platyrhynchos 56.90 1.00e-37 146.00
IUUC-Aca-005288 Anolis carolinensis 59.48 8.00e-40 153.00
IUUC-Aly-005554 Arabidopsis lyrata 80.00 2.00e-45 172.00
IUUC-Ath-006958 Arabidopsis thaliana 79.13 6.00e-45 170.00
IUUC-Ago-007898 Ashbya gossypii 71.05 1.00e-47 179.00
IUUC-Acl-008314 Aspergillus clavatus 87.07 2.00e-57 211.00
IUUC-Afl-008708 Aspergillus flavus 86.44 6.00e-58 213.00
IUUC-Afu-009097 Aspergillus fumigatus 87.07 2.00e-57 211.00
IUUC-Ani-009196 Aspergillus nidulans 86.21 1.00e-56 209.00
IUUC-Ang-009530 Aspergillus niger 87.07 2.00e-57 211.00
IUUC-Aor-009909 Aspergillus oryzae 86.44 6.00e-58 213.00
IUUC-Ate-010358 Aspergillus terreus 87.07 2.00e-57 211.00
IUUC-Ame-010751 Astyanax mexicanus 60.34 2.00e-40 155.00
IUUC-Bgr-012248 Blumeria graminis 86.32 4.00e-57 211.00
IUUC-Bta-012520 Bos taurus 60.34 5.00e-40 154.00
IUUC-Bci-013959 Botrytis cinerea 88.03 2.00e-58 215.00
IUUC-Bdi-014320 Brachypodium distachyon 80.00 8.00e-52 193.00
IUUC-Bol-015168 Brassica oleracea 80.87 7.00e-52 195.00
IUUC-Bra-017452 Brassica rapa 80.87 1.00e-52 196.00
IUUC-Cel-018200 Caenorhabditis elegans 57.76 6.00e-39 150.00
IUUC-Cja-019273 Callithrix jacchus 59.48 8.00e-40 153.00
IUUC-Cfa-020373 Canis familiaris 60.34 4.00e-40 154.00
IUUC-Cpo-021831 Cavia porcellus 60.34 4.00e-40 154.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 83.19 4.00e-47 178.00
IUUC-Csa-024201 Chlorocebus sabaeus 60.34 4.00e-40 154.00
IUUC-Cho-025008 Choloepus hoffmanni 52.99 3.00e-35 138.00
IUUC-Cin-025297 Ciona intestinalis 57.76 5.00e-39 150.00
IUUC-Csv-026146 Ciona savignyi 38.46 4.00e-23 98.20
IUUC-Cgl-026691 Colletotrichum gloeosporioides 63.12 8.00e-51 191.00
IUUC-Cne-026889 Cryptococcus neoformans 83.90 2.00e-56 208.00
IUUC-Dre-028371 Danio rerio 59.48 1.00e-39 152.00
IUUC-Dno-029331 Dasypus novemcinctus 60.34 3.00e-40 154.00
IUUC-Dor-030453 Dipodomys ordii 60.34 4.00e-40 154.00
IUUC-Dse-031428 Dothistroma septosporum 86.32 8.00e-58 213.00
IUUC-Dme-031813 Drosophila melanogaster 60.34 2.00e-40 155.00
IUUC-Ete-032671 Echinops telfairi 59.48 8.00e-39 150.00
IUUC-Eca-034113 Equus caballus 60.34 6.00e-40 154.00
IUUC-Eeu-035131 Erinaceus europaeus 55.81 2.00e-25 104.00
IUUC-Fca-036385 Felis catus 60.34 4.00e-40 154.00
IUUC-Fal-036896 Ficedula albicollis 59.48 1.00e-39 152.00
IUUC-Fox-037846 Fusarium oxysporum 87.07 1.00e-57 212.00
IUUC-Fso-038134 Fusarium solani 87.07 2.00e-57 212.00
IUUC-Gmo-039289 Gadus morhua 59.48 7.00e-40 153.00
IUUC-Ggr-039770 Gaeumannomyces graminis 82.20 3.00e-55 204.00
IUUC-Gga-040257 Gallus gallus 58.62 1.00e-38 149.00
IUUC-Gac-041604 Gasterosteus aculeatus 60.34 4.00e-40 154.00
IUUC-Gma-043572 Glycine max 80.34 7.00e-46 173.00
IUUC-Ggo-044429 Gorilla gorilla 60.34 4.00e-40 154.00
IUUC-Hsa-046764 Homo sapiens 60.34 4.00e-40 154.00
IUUC-Hvu-047588 Hordeum vulgare 76.92 1.00e-50 189.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 58.62 2.00e-38 149.00
IUUC-Kpa-049124 Komagataella pastoris 77.12 7.00e-52 193.00
IUUC-Lch-049542 Latimeria chalumnae 59.48 4.00e-40 154.00
IUUC-Lpe-051292 Leersia perrieri 80.00 2.00e-52 195.00
IUUC-Loc-052290 Lepisosteus oculatus 58.62 3.00e-38 149.00
IUUC-Laf-054203 Loxodonta africana 58.62 2.00e-38 149.00
IUUC-Mcc-055307 Macaca mulatta 58.62 2.00e-38 149.00
IUUC-Meu-056515 Macropus eugenii 60.34 4.00e-40 154.00
IUUC-Mor-057276 Magnaporthe oryzae 83.05 1.00e-55 206.00
IUUC-Mpo-057469 Magnaporthe poae 81.36 2.00e-54 202.00
IUUC-Mtr-058417 Medicago truncatula 80.34 9.00e-46 173.00
IUUC-Mla-059098 Melampsora laricipopulina 95.69 1.00e-62 229.00
IUUC-Mga-060108 Meleagris gallopavo 55.93 8.00e-38 147.00
IUUC-Mvi-060496 Microbotryum violaceum 90.43 3.00e-59 218.00
IUUC-Mmr-061776 Microcebus murinus 58.62 2.00e-38 149.00
IUUC-Mdo-061915 Monodelphis domestica 60.34 5.00e-40 154.00
IUUC-Mmu-064152 Mus musculus 60.34 4.00e-40 154.00
IUUC-Mac-064522 Musa acuminata 77.78 2.00e-45 171.00
IUUC-Mpu-066760 Mustela putorius furo 60.34 4.00e-40 154.00
IUUC-Mlu-068211 Myotis lucifugus 60.34 4.00e-40 154.00
IUUC-Nfi-068367 Neosartorya fischeri 87.07 2.00e-57 211.00
IUUC-Ncr-068894 Neurospora crassa 85.59 1.00e-57 212.00
IUUC-Nle-069755 Nomascus leucogenys 60.34 4.00e-40 154.00
IUUC-Opr-070777 Ochotona princeps 58.62 2.00e-38 149.00
IUUC-Ont-072343 Oreochromis niloticus 60.34 4.00e-40 154.00
IUUC-Oan-073485 Ornithorhynchus anatinus 61.90 2.00e-36 142.00
IUUC-Ocu-073861 Oryctolagus cuniculus 60.34 4.00e-40 154.00
IUUC-Oba-075722 Oryza barthii 77.78 3.00e-52 194.00
IUUC-Obr-076374 Oryza brachyantha 80.00 7.00e-52 193.00
IUUC-Ogl-077551 Oryza glaberrima 77.78 3.00e-52 194.00
IUUC-Ogu-078499 Oryza glumaepatula 77.78 3.00e-52 194.00
IUUC-Oin-079771 Oryza indica 80.00 7.00e-52 193.00
IUUC-Olo-080412 Oryza longistaminata 80.00 7.00e-52 193.00
IUUC-Ome-081791 Oryza meridionalis 80.00 7.00e-52 193.00
IUUC-Oni-082774 Oryza nivara 80.00 7.00e-52 193.00
IUUC-Opu-083486 Oryza punctata 80.00 3.00e-51 193.00
IUUC-Oru-084425 Oryza rufipogon 77.78 7.00e-52 193.00
IUUC-Osa-085439 Oryza sativa 80.00 7.00e-52 193.00
IUUC-Ola-086310 Oryzias latipes 59.48 1.00e-39 152.00
IUUC-Olu-087892 Ostreococcus lucimarinus 77.88 2.00e-50 189.00
IUUC-Oga-088483 Otolemur garnettii 60.34 4.00e-40 154.00
IUUC-Oar-089989 Ovis aries 58.62 2.00e-38 149.00
IUUC-Ptr-091560 Pan troglodytes 60.34 4.00e-40 154.00
IUUC-Pan-092269 Papio anubis 60.34 4.00e-40 154.00
IUUC-Psi-093055 Pelodiscus sinensis 56.41 8.00e-38 146.00
IUUC-Pma-094337 Petromyzon marinus 57.26 8.00e-41 157.00
IUUC-Pno-095035 Phaeosphaeria nodorum 86.32 1.00e-57 212.00
IUUC-Ppa-095257 Physcomitrella patens 78.26 4.00e-51 191.00
IUUC-Pfo-096380 Poecilia formosa 59.48 6.00e-40 154.00
IUUC-Pab-098563 Pongo abelii 60.34 4.00e-40 154.00
IUUC-Pop-100069 Populus trichocarpa 80.87 1.00e-45 173.00
IUUC-Pca-100230 Procavia capensis 58.62 2.00e-38 149.00
IUUC-Ppe-101863 Prunus persica 81.74 2.00e-45 172.00
IUUC-Pva-103103 Pteropus vampyrus 56.41 8.00e-38 146.00
IUUC-Pte-104230 Pyrenophora teres 86.32 1.00e-57 213.00
IUUC-Rno-105111 Rattus norvegicus 60.34 4.00e-40 154.00
IUUC-Sce-106150 Saccharomyces cerevisiae 76.07 3.00e-51 191.00
IUUC-Sha-106656 Sarcophilus harrisii 58.62 2.00e-38 149.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 82.05 6.00e-56 207.00
IUUC-Spo-108156 Schizosaccharomyces pombe 80.51 3.00e-48 181.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 88.03 1.00e-58 215.00
IUUC-Smo-109082 Selaginella moellendorffii 80.87 4.00e-53 197.00
IUUC-Sit-110531 Setaria italica 79.82 2.00e-51 192.00
IUUC-Sly-111799 Solanum lycopersicum 78.63 1.00e-46 176.00
IUUC-Stu-112612 Solanum tuberosum 78.63 3.00e-52 194.00
IUUC-Sar-113670 Sorex araneus 53.45 4.00e-34 134.00
IUUC-Sbi-114346 Sorghum bicolor 80.00 8.00e-52 193.00
IUUC-Sre-114964 Sporisorium reilianum 100.00 2.00e-65 238.00
IUUC-Ssc-115828 Sus scrofa 60.34 4.00e-40 154.00
IUUC-Tgu-117195 Taeniopygia guttata 59.48 1.00e-39 153.00
IUUC-Tru-118632 Takifugu rubripes 58.62 2.00e-38 149.00
IUUC-Tsy-118919 Tarsius syrichta 56.41 8.00e-38 146.00
IUUC-Tni-120706 Tetraodon nigroviridis 59.48 1.00e-39 152.00
IUUC-Tca-121217 Theobroma cacao 80.34 6.00e-46 173.00
IUUC-Tre-122077 Trichoderma reesei 87.07 1.00e-57 212.00
IUUC-Tvi-122400 Trichoderma virens 87.07 1.00e-57 212.00
IUUC-Tae-122697 Triticum aestivum 74.14 3.00e-50 189.00
IUUC-Tur-126158 Triticum urartu 73.28 7.00e-50 187.00
IUUC-Tme-126955 Tuber melanosporum 87.07 1.00e-57 213.00
IUUC-Tbe-127765 Tupaia belangeri 62.79 1.00e-29 119.00
IUUC-Ttr-128205 Tursiops truncatus 60.34 4.00e-40 154.00
IUUC-Vda-129807 Verticillium dahliae 87.07 2.00e-57 212.00
IUUC-Vpa-130804 Vicugna pacos 59.48 9.00e-40 153.00
IUUC-Vvi-130830 Vitis vinifera 79.49 5.00e-46 174.00
IUUC-Xtr-132685 Xenopus tropicalis 60.34 2.00e-40 155.00
IUUC-Xma-133675 Xiphophorus maculatus 59.48 6.00e-40 154.00
IUUC-Yli-134327 Yarrowia lipolytica 82.20 4.00e-48 181.00
IUUC-Zma-135270 Zea mays 80.34 9.00e-53 196.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved