• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
UUCD2 ID IUUC-Pma-094380
UUCD1 version UUC-PeM-00502
Ensembl Protein ID ENSPMAP00000008275.1
UniProt Accession S4RST5; S4RST5_PETMA
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSPMAG00000007476.1 ENSPMAT00000008313.1 ENSPMAP00000008275.1
Status Unreviewed
Classification
Family E-Value Score Start End
E1 1.70e-95 319.9 13 500
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvn 89
    YDRQ+rlwG+++q++l++a+v+l++a ++G+E+lKnLvl G+g +t++D+++v+ ++++++F+++++++g s+A++a++ ++eln+dv+
   Q: 13 YDRQLRLWGDHGQQALENAHVCLINASATGTEILKNLVLPGIGAFTILDGNKVSGEDIGNNFFLDKSSIGESRAKTAMNLIQELNSDVS 101
    ***************************************************************************************** PP
   S: 90 veaheesiteleeeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfc 174
    + ++ee +++ e+++ Ff kf+vV++++ + ++ ++++ ++++a vpl+ ++++G+ G++rv ++++t+ +s++d ++++++ Pf+
   Q: 102 GNFVEEAVEKVLEKEPtFFHKFTVVITTQLPQSTLLRLAAALWEAGVPLLACRAYGMTGYMRVALREHTVVESHPDnalEDLRLDRPFP 190
    **************99************************************************************************* PP
   S: 175 tlketpn.........aaehtiewavlfnklleeeageeevlekldseekeegkdkvkselks......edeenfeeaieiavkafakt 248
    l ++ + +++++++w v+++k+l+ ++++++++ +++++ek ++k+++++++ + eenfeeai+++++a+++t
   Q: 191 ALVKHLAscdlalldkKEHSHTPWLVVVAKYLDVWRSQHDGSLPKNYKEKDQFKELIRQGMIKnehgasSVEENFEEAIKNTTTALNPT 279
    *****77788888888**********************************************999999999****************** PP
   S: 249 tins.ikqllksfecdivtkskspfwv.............................................................. 274
    i++ ++ql+++++c+ ++ ++++fwv
   Q: 280 RIPDvVRQLFSDPSCQSLSAKSADFWVlvralrdfveaeggegalplrgsipdmiadsdkfvrlqnvyrekakqdadavgkltasllhs 368
    ***************************************************************************************** PP
   S: 275 ..............sfcsnaealqvp.............ekvekdeevvkasap................lylllralerfekkkgrkp 320
    fc+ a+ l+v l ++lra++rf +++gr+p
   Q: 369 lgrpadgisegdvrLFCKHAAFLRVVrcrslaeeydaktA-------------LtadigsqlesaegeavLNIMLRAVDRFYQQYGRYP 444
    **************99999999996655544444444332.............12222233333346788******************* PP
   S: 321 gelsfekdddsavdlvtaaanlraeslgiepkldddlikeiagniipaiattnavvgG 378
    g+ ++d d + +l + +a l ++ g+ ++d++++e++++++++ +t+++++gG
   Q: 445 GVRAEDVDRD-VAELRACVAGLL-HEWGLHCTVKDEYLHEFCRYGAAEPHTVASFIGG 500
    8888888888.888888888777.999*9999*************************9 PP
   

Organism Petromyzon marinus
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M.
Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M.
Protein Sequence
(Fasta)
KSQTLAKEKE RRYDRQLRLW GDHGQQALEN AHVCLINASA TGTEILKNLV LPGIGAFTIL 60
DGNKVSGEDI GNNFFLDKSS IGESRAKTAM NLIQELNSDV SGNFVEEAVE KVLEKEPTFF 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pma-094380|E1,E1_ThiF|Petromyzon marinus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AAGAGCCAGA CGCTCGCCAA GGAGAAAGAG AGGAGATACG ACCGACAGCT GAGGTGAATG 60
CCGCCCCTTG CGACGCCTGG CGGCCTCGCG CGCTCGCCGT TTTGTTTTTG AGGGAGGCGC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pma-094380|E1,E1_ThiF|Petromyzon marinus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 40.52 1.00e-110 391.00
IUUC-Aml-002333 Ailuropoda melanoleuca 61.62 0.00e+00 676.00
IUUC-Atr-002644 Amborella trichopoda 39.47 4.00e-100 357.00
IUUC-Apl-003446 Anas platyrhynchos 62.89 0.00e+00 658.00
IUUC-Aca-004450 Anolis carolinensis 59.55 0.00e+00 657.00
IUUC-Aly-006187 Arabidopsis lyrata 40.28 3.00e-113 400.00
IUUC-Ath-007600 Arabidopsis thaliana 40.73 1.00e-115 408.00
IUUC-Ago-007900 Ashbya gossypii 28.79 7.00e-33 133.00
IUUC-Acl-008333 Aspergillus clavatus 37.72 2.00e-76 278.00
IUUC-Afl-008529 Aspergillus flavus 34.49 1.00e-79 288.00
IUUC-Afu-009071 Aspergillus fumigatus 38.88 7.00e-76 276.00
IUUC-Ani-009443 Aspergillus nidulans 38.93 2.00e-73 268.00
IUUC-Ang-009669 Aspergillus niger 38.50 4.00e-77 280.00
IUUC-Aor-009914 Aspergillus oryzae 34.16 3.00e-77 281.00
IUUC-Ate-010450 Aspergillus terreus 35.19 9.00e-78 283.00
IUUC-Ame-011183 Astyanax mexicanus 63.29 0.00e+00 684.00
IUUC-Bgr-012111 Blumeria graminis 36.57 9.00e-58 216.00
IUUC-Bta-012583 Bos taurus 61.46 0.00e+00 674.00
IUUC-Bci-013892 Botrytis cinerea 37.78 7.00e-60 223.00
IUUC-Bdi-014592 Brachypodium distachyon 41.85 4.00e-112 396.00
IUUC-Bol-016399 Brassica oleracea 39.92 2.00e-112 397.00
IUUC-Bra-017506 Brassica rapa 39.20 1.00e-108 385.00
IUUC-Cel-018456 Caenorhabditis elegans 32.34 5.00e-77 280.00
IUUC-Cja-020007 Callithrix jacchus 61.49 0.00e+00 674.00
IUUC-Cfa-020324 Canis familiaris 62.07 0.00e+00 683.00
IUUC-Cpo-022248 Cavia porcellus 53.56 4.00e-113 399.00
IUUC-Csa-023149 Chlorocebus sabaeus 57.08 2.00e-157 547.00
IUUC-Cho-024537 Choloepus hoffmanni 49.30 2.00e-130 457.00
IUUC-Cin-025763 Ciona intestinalis 50.50 3.00e-149 520.00
IUUC-Csv-026113 Ciona savignyi 47.39 9.00e-144 501.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 34.22 2.00e-59 221.00
IUUC-Cne-026884 Cryptococcus neoformans 30.69 9.00e-66 243.00
IUUC-Cme-027210 Cyanidioschyzon merolae 26.58 7.00e-19 87.40
IUUC-Dre-028140 Danio rerio 62.07 0.00e+00 676.00
IUUC-Dno-030033 Dasypus novemcinctus 61.12 0.00e+00 625.00
IUUC-Dor-030513 Dipodomys ordii 41.46 1.00e-102 365.00
IUUC-Dse-031536 Dothistroma septosporum 34.27 8.00e-77 279.00
IUUC-Dme-031683 Drosophila melanogaster 46.17 2.00e-121 427.00
IUUC-Ete-032420 Echinops telfairi 52.80 5.00e-160 555.00
IUUC-Eca-033992 Equus caballus 58.25 7.00e-155 538.00
IUUC-Eeu-034713 Erinaceus europaeus 43.89 2.00e-54 205.00
IUUC-Fca-036548 Felis catus 61.66 0.00e+00 679.00
IUUC-Fal-037600 Ficedula albicollis 62.92 0.00e+00 659.00
IUUC-Fox-038037 Fusarium oxysporum 36.32 2.00e-68 251.00
IUUC-Fso-038387 Fusarium solani 36.32 3.00e-65 241.00
IUUC-Gmo-038562 Gadus morhua 60.04 0.00e+00 667.00
IUUC-Ggr-040005 Gaeumannomyces graminis 35.12 4.00e-65 240.00
IUUC-Gga-041129 Gallus gallus 62.01 0.00e+00 663.00
IUUC-Gac-042558 Gasterosteus aculeatus 60.40 0.00e+00 663.00
IUUC-Gma-043610 Glycine max 40.49 3.00e-110 390.00
IUUC-Ggo-045611 Gorilla gorilla 61.69 0.00e+00 674.00
IUUC-Hsa-046563 Homo sapiens 62.07 0.00e+00 679.00
IUUC-Hvu-047790 Hordeum vulgare 36.49 2.00e-63 234.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 61.87 0.00e+00 672.00
IUUC-Kpa-049309 Komagataella pastoris 33.40 9.00e-71 259.00
IUUC-Lch-050038 Latimeria chalumnae 62.15 0.00e+00 673.00
IUUC-Lpe-051535 Leersia perrieri 38.91 3.00e-99 353.00
IUUC-Loc-051917 Lepisosteus oculatus 58.42 4.00e-177 612.00
IUUC-Lma-053112 Leptosphaeria maculans 33.72 2.00e-75 275.00
IUUC-Laf-053690 Loxodonta africana 61.87 0.00e+00 680.00
IUUC-Mcc-055117 Macaca mulatta 60.36 0.00e+00 659.00
IUUC-Meu-056761 Macropus eugenii 50.00 2.00e-146 510.00
IUUC-Mor-057230 Magnaporthe oryzae 33.98 6.00e-68 250.00
IUUC-Mpo-057514 Magnaporthe poae 35.85 3.00e-66 244.00
IUUC-Mtr-058551 Medicago truncatula 40.20 3.00e-106 377.00
IUUC-Mla-059183 Melampsora laricipopulina 39.88 6.00e-98 349.00
IUUC-Mga-060144 Meleagris gallopavo 61.20 0.00e+00 647.00
IUUC-Mvi-060221 Microbotryum violaceum 39.08 2.00e-77 281.00
IUUC-Mmr-061325 Microcebus murinus 60.28 0.00e+00 661.00
IUUC-Mdo-062532 Monodelphis domestica 62.27 0.00e+00 679.00
IUUC-Mmu-063956 Mus musculus 62.07 0.00e+00 678.00
IUUC-Mac-064521 Musa acuminata 40.24 4.00e-112 396.00
IUUC-Mpu-066716 Mustela putorius furo 61.51 0.00e+00 674.00
IUUC-Mlu-067459 Myotis lucifugus 61.45 0.00e+00 679.00
IUUC-Nfi-068245 Neosartorya fischeri 37.39 4.00e-75 274.00
IUUC-Ncr-068910 Neurospora crassa 36.91 1.00e-67 249.00
IUUC-Nle-070034 Nomascus leucogenys 60.74 0.00e+00 647.00
IUUC-Opr-070552 Ochotona princeps 56.88 2.00e-168 583.00
IUUC-Ont-071426 Oreochromis niloticus 62.68 0.00e+00 686.00
IUUC-Oan-073389 Ornithorhynchus anatinus 55.80 4.00e-146 509.00
IUUC-Ocu-074911 Oryctolagus cuniculus 62.68 0.00e+00 682.00
IUUC-Oba-075437 Oryza barthii 40.64 8.00e-102 362.00
IUUC-Obr-076684 Oryza brachyantha 40.53 2.00e-94 338.00
IUUC-Ogl-077170 Oryza glaberrima 40.64 8.00e-102 362.00
IUUC-Ogu-078844 Oryza glumaepatula 40.85 1.00e-101 361.00
IUUC-Oin-079105 Oryza indica 40.64 3.00e-101 360.00
IUUC-Olo-080943 Oryza longistaminata 37.90 5.00e-95 339.00
IUUC-Oni-082891 Oryza nivara 37.63 8.00e-94 335.00
IUUC-Opu-083457 Oryza punctata 40.64 2.00e-101 360.00
IUUC-Oru-084960 Oryza rufipogon 37.90 5.00e-95 340.00
IUUC-Osa-085358 Oryza sativa 41.01 1.00e-101 362.00
IUUC-Ola-086420 Oryzias latipes 57.35 5.00e-124 436.00
IUUC-Olu-087625 Ostreococcus lucimarinus 30.02 8.00e-48 183.00
IUUC-Oga-088810 Otolemur garnettii 61.05 0.00e+00 676.00
IUUC-Oar-089196 Ovis aries 61.29 0.00e+00 671.00
IUUC-Ptr-090617 Pan troglodytes 62.07 0.00e+00 679.00
IUUC-Pan-092761 Papio anubis 62.27 0.00e+00 681.00
IUUC-Psi-093191 Pelodiscus sinensis 61.16 0.00e+00 662.00
IUUC-Pno-095084 Phaeosphaeria nodorum 32.55 9.00e-66 244.00
IUUC-Ppa-095798 Physcomitrella patens 39.41 1.00e-108 385.00
IUUC-Pfo-096467 Poecilia formosa 61.49 0.00e+00 671.00
IUUC-Pab-098255 Pongo abelii 62.93 1.00e-174 603.00
IUUC-Pop-099722 Populus trichocarpa 40.93 1.00e-116 411.00
IUUC-Pca-100807 Procavia capensis 55.47 4.00e-84 303.00
IUUC-Ppe-101280 Prunus persica 40.28 5.00e-112 396.00
IUUC-Pva-102333 Pteropus vampyrus 60.89 0.00e+00 648.00
IUUC-Pgr-103401 Puccinia graminis 29.84 2.00e-66 245.00
IUUC-Ptt-103889 Puccinia triticina 29.19 1.00e-55 209.00
IUUC-Pte-104355 Pyrenophora teres 33.52 3.00e-73 268.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 33.71 2.00e-74 271.00
IUUC-Rno-105810 Rattus norvegicus 61.87 0.00e+00 675.00
IUUC-Sce-106397 Saccharomyces cerevisiae 27.68 2.00e-31 128.00
IUUC-Sha-106770 Sarcophilus harrisii 68.13 2.00e-116 410.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 31.64 3.00e-63 234.00
IUUC-Spo-108276 Schizosaccharomyces pombe 30.32 1.00e-64 238.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 38.65 9.00e-63 233.00
IUUC-Smo-109296 Selaginella moellendorffii 40.88 3.00e-107 380.00
IUUC-Sit-110157 Setaria italica 41.94 1.00e-117 415.00
IUUC-Sly-111105 Solanum lycopersicum 39.88 3.00e-113 400.00
IUUC-Stu-112469 Solanum tuberosum 39.49 4.00e-114 403.00
IUUC-Sar-113083 Sorex araneus 45.76 3.00e-132 463.00
IUUC-Sbi-113813 Sorghum bicolor 41.45 2.00e-116 410.00
IUUC-Sre-115058 Sporisorium reilianum 38.27 1.00e-80 292.00
IUUC-Tgu-116772 Taeniopygia guttata 62.68 0.00e+00 662.00
IUUC-Tru-118686 Takifugu rubripes 59.43 0.00e+00 664.00
IUUC-Tsy-119111 Tarsius syrichta 62.55 9.00e-104 369.00
IUUC-Tni-120231 Tetraodon nigroviridis 55.04 5.00e-174 602.00
IUUC-Tca-121491 Theobroma cacao 39.88 3.00e-105 374.00
IUUC-Tre-122103 Trichoderma reesei 36.91 6.00e-68 250.00
IUUC-Tvi-122672 Trichoderma virens 37.30 9.00e-68 249.00
IUUC-Tae-125679 Triticum aestivum 41.13 3.00e-112 397.00
IUUC-Tur-126487 Triticum urartu 39.63 5.00e-106 376.00
IUUC-Tme-127097 Tuber melanosporum 35.60 1.00e-82 298.00
IUUC-Ttr-128465 Tursiops truncatus 58.06 3.00e-179 620.00
IUUC-Uma-129645 Ustilago maydis 37.99 3.00e-82 297.00
IUUC-Vda-129989 Verticillium dahliae 32.67 1.00e-50 192.00
IUUC-Vpa-130529 Vicugna pacos 58.47 0.00e+00 629.00
IUUC-Vvi-131059 Vitis vinifera 40.73 2.00e-111 394.00
IUUC-Xtr-132002 Xenopus tropicalis 64.10 0.00e+00 701.00
IUUC-Xma-133930 Xiphophorus maculatus 62.47 0.00e+00 681.00
IUUC-Yli-134505 Yarrowia lipolytica 31.23 4.00e-68 250.00
IUUC-Zma-135895 Zea mays 41.45 5.00e-115 406.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved