• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
iUUCD ID IUUC-Kpa-049225
Ensembl Protein ID CAY70401
UniProt Accession C4R4B5; C4R4B5_KOMPG
Genbank Protein ID CAY70401.1
Protein Name Ubiquitin-conjugating enzyme (E2)
Genbank Nucleotide ID FN392321
Gene Name PAS_chr3_0359
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
PAS_chr3_0359 CAY70401 CAY70401
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 4.10e-51 170.5 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++d p g+sa+p + ++++w+++i+Gp+dtp+e+g+F+l i+f+e+YP kPP+vkf++ +fhPnvy++G++Cl+il+ ++W+p+++v+s+
   Q: 8 RLMRDFKRIQQDAPGGVSASPLPD-NVMTWNAVIVGPADTPFEDGTFRLVIQFDEQYPNKPPSVKFISDMFHPNVYASGDLCLDILQ--NRWTPTYDVSSI 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+siqsll++pn++sp+n+eaa+l+k++r++y ++vr
   Q: 106 LTSIQSLLNDPNISSPANVEAANLYKDHRSQYIQRVR 142
    **********************************997 PP
   

Organism Komagataella pastoris
Protein Sequence
(Fasta)
MSTPARRRLM RDFKRIQQDA PGGVSASPLP DNVMTWNAVI VGPADTPFED GTFRLVIQFD 60
EQYPNKPPSV KFISDMFHPN VYASGDLCLD ILQNRWTPTY DVSSILTSIQ SLLNDPNISS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Kpa-049225|E2,E2/UBC|Komagataella pastoris
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCTACTC CTGCAAGACG ACGATTGATG AGAGATTTCA AAGTAAGTGT TTTCCAAACG 60
TCTTATCAGT ATGCACTTTG AACTAACAAT TTATTTAGAG AATCCAACAG GATGCACCGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Kpa-049225|E2,E2/UBC|Komagataella pastoris
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG ppa:PAS_chr3_0359
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 62.00 2.00e-58 215.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.33 3.00e-63 231.00
IUUC-Atr-002862 Amborella trichopoda 64.00 3.00e-59 218.00
IUUC-Apl-004063 Anas platyrhynchos 61.22 1.00e-51 193.00
IUUC-Aca-005001 Anolis carolinensis 68.67 5.00e-63 230.00
IUUC-Aly-005584 Arabidopsis lyrata 65.33 6.00e-60 220.00
IUUC-Ath-007149 Arabidopsis thaliana 65.33 6.00e-60 220.00
IUUC-Ago-007745 Ashbya gossypii 80.00 3.00e-75 271.00
IUUC-Acl-008139 Aspergillus clavatus 82.55 1.00e-74 269.00
IUUC-Afl-008551 Aspergillus flavus 82.55 1.00e-74 269.00
IUUC-Afu-008980 Aspergillus fumigatus 82.55 1.00e-74 269.00
IUUC-Ang-009554 Aspergillus niger 82.55 1.00e-74 269.00
IUUC-Aor-010242 Aspergillus oryzae 82.55 1.00e-74 269.00
IUUC-Ate-010390 Aspergillus terreus 82.55 1.00e-74 269.00
IUUC-Ame-010743 Astyanax mexicanus 70.47 1.00e-63 232.00
IUUC-Bgr-012039 Blumeria graminis 80.60 1.00e-65 239.00
IUUC-Bta-012840 Bos taurus 69.33 3.00e-63 231.00
IUUC-Bci-013919 Botrytis cinerea 80.54 3.00e-73 265.00
IUUC-Bdi-014308 Brachypodium distachyon 63.33 9.00e-59 216.00
IUUC-Bol-015726 Brassica oleracea 65.33 1.00e-59 222.00
IUUC-Bra-016809 Brassica rapa 65.33 5.00e-60 221.00
IUUC-Cel-018244 Caenorhabditis elegans 66.44 3.00e-62 228.00
IUUC-Cja-019737 Callithrix jacchus 69.33 3.00e-63 231.00
IUUC-Cfa-020244 Canis familiaris 69.33 3.00e-63 231.00
IUUC-Cpo-021323 Cavia porcellus 69.80 3.00e-63 231.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 66.67 3.00e-51 191.00
IUUC-Csa-023430 Chlorocebus sabaeus 69.33 3.00e-63 231.00
IUUC-Cho-024773 Choloepus hoffmanni 54.00 1.00e-42 162.00
IUUC-Cin-025537 Ciona intestinalis 70.00 2.00e-54 202.00
IUUC-Csv-025846 Ciona savignyi 70.67 2.00e-57 212.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 82.55 1.00e-75 272.00
IUUC-Cne-026864 Cryptococcus neoformans 68.46 9.00e-63 230.00
IUUC-Cme-027284 Cyanidioschyzon merolae 60.00 3.00e-47 179.00
IUUC-Dre-028358 Danio rerio 69.13 4.00e-63 231.00
IUUC-Dno-029661 Dasypus novemcinctus 69.33 3.00e-63 231.00
IUUC-Dor-030452 Dipodomys ordii 65.93 1.00e-53 199.00
IUUC-Dse-031487 Dothistroma septosporum 81.21 5.00e-74 267.00
IUUC-Dme-031863 Drosophila melanogaster 69.80 7.00e-63 230.00
IUUC-Ete-032595 Echinops telfairi 68.00 3.00e-62 228.00
IUUC-Eca-033377 Equus caballus 69.33 3.00e-63 231.00
IUUC-Eeu-035191 Erinaceus europaeus 54.30 4.00e-42 161.00
IUUC-Fca-036336 Felis catus 69.33 3.00e-63 231.00
IUUC-Fal-037474 Ficedula albicollis 68.97 4.00e-48 180.00
IUUC-Fox-037808 Fusarium oxysporum 82.55 2.00e-75 271.00
IUUC-Fso-038232 Fusarium solani 82.55 1.00e-75 272.00
IUUC-Gmo-038517 Gadus morhua 69.13 4.00e-63 231.00
IUUC-Ggr-039875 Gaeumannomyces graminis 82.55 4.00e-75 271.00
IUUC-Gga-040494 Gallus gallus 69.33 3.00e-63 231.00
IUUC-Gac-042471 Gasterosteus aculeatus 68.46 2.00e-63 231.00
IUUC-Gma-043865 Glycine max 64.00 1.00e-59 219.00
IUUC-Ggo-044896 Gorilla gorilla 69.13 4.00e-63 231.00
IUUC-Hsa-046239 Homo sapiens 69.33 3.00e-63 231.00
IUUC-Hvu-047054 Hordeum vulgare 62.00 2.00e-58 215.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 69.33 3.00e-63 231.00
IUUC-Lch-049964 Latimeria chalumnae 69.13 4.00e-63 231.00
IUUC-Lpe-051301 Leersia perrieri 64.00 3.00e-59 218.00
IUUC-Loc-051962 Lepisosteus oculatus 70.00 7.00e-64 233.00
IUUC-Laf-053380 Loxodonta africana 69.33 3.00e-63 231.00
IUUC-Mcc-054819 Macaca mulatta 69.33 2.00e-63 232.00
IUUC-Meu-056231 Macropus eugenii 69.13 4.00e-63 231.00
IUUC-Mor-057087 Magnaporthe oryzae 82.09 6.00e-67 243.00
IUUC-Mpo-057498 Magnaporthe poae 82.55 2.00e-75 272.00
IUUC-Mtr-058305 Medicago truncatula 64.00 2.00e-59 219.00
IUUC-Mla-058876 Melampsora laricipopulina 73.15 1.00e-60 223.00
IUUC-Mga-059863 Meleagris gallopavo 66.18 2.00e-54 202.00
IUUC-Mvi-060330 Microbotryum violaceum 72.48 1.00e-59 219.00
IUUC-Mmr-060630 Microcebus murinus 69.33 3.00e-63 231.00
IUUC-Mdo-062676 Monodelphis domestica 69.33 3.00e-63 231.00
IUUC-Mmu-063491 Mus musculus 69.33 3.00e-63 231.00
IUUC-Mac-064774 Musa acuminata 64.00 4.00e-59 218.00
IUUC-Mpu-065803 Mustela putorius furo 69.33 3.00e-63 231.00
IUUC-Mlu-067147 Myotis lucifugus 69.33 3.00e-63 231.00
IUUC-Nfi-068580 Neosartorya fischeri 82.55 1.00e-74 269.00
IUUC-Ncr-068913 Neurospora crassa 82.55 3.00e-75 271.00
IUUC-Nle-070105 Nomascus leucogenys 69.33 3.00e-63 231.00
IUUC-Opr-070935 Ochotona princeps 69.33 3.00e-63 231.00
IUUC-Ont-071335 Oreochromis niloticus 68.46 3.00e-63 231.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.27 6.00e-56 207.00
IUUC-Ocu-074130 Oryctolagus cuniculus 69.33 3.00e-63 231.00
IUUC-Oba-075896 Oryza barthii 64.00 7.00e-59 216.00
IUUC-Obr-076770 Oryza brachyantha 64.67 3.00e-59 218.00
IUUC-Ogl-077116 Oryza glaberrima 64.00 3.00e-59 218.00
IUUC-Ogu-078696 Oryza glumaepatula 64.00 3.00e-59 218.00
IUUC-Oin-079099 Oryza indica 64.00 3.00e-59 218.00
IUUC-Olo-081018 Oryza longistaminata 54.55 1.00e-49 186.00
IUUC-Ome-081285 Oryza meridionalis 64.00 3.00e-59 218.00
IUUC-Oni-082088 Oryza nivara 64.00 3.00e-59 218.00
IUUC-Opu-083310 Oryza punctata 64.00 3.00e-59 218.00
IUUC-Oru-084449 Oryza rufipogon 64.00 3.00e-59 218.00
IUUC-Osa-085923 Oryza sativa 64.00 3.00e-59 218.00
IUUC-Ola-087448 Oryzias latipes 69.33 3.00e-63 231.00
IUUC-Olu-087830 Ostreococcus lucimarinus 63.76 2.00e-50 188.00
IUUC-Oga-088836 Otolemur garnettii 69.33 3.00e-63 231.00
IUUC-Oar-090141 Ovis aries 69.33 3.00e-63 231.00
IUUC-Ptr-091453 Pan troglodytes 69.33 3.00e-63 231.00
IUUC-Pan-092511 Papio anubis 69.33 3.00e-63 231.00
IUUC-Psi-094094 Pelodiscus sinensis 69.13 4.00e-63 231.00
IUUC-Pma-094376 Petromyzon marinus 68.46 2.00e-62 228.00
IUUC-Pno-094935 Phaeosphaeria nodorum 80.54 2.00e-73 265.00
IUUC-Ppa-095689 Physcomitrella patens 67.72 7.00e-52 193.00
IUUC-Pfo-096784 Poecilia formosa 69.13 5.00e-63 230.00
IUUC-Pab-098121 Pongo abelii 69.33 3.00e-63 231.00
IUUC-Pop-099712 Populus trichocarpa 64.00 3.00e-54 201.00
IUUC-Pca-100906 Procavia capensis 63.76 3.00e-56 208.00
IUUC-Ppe-101594 Prunus persica 64.00 2.00e-59 218.00
IUUC-Pva-102380 Pteropus vampyrus 68.46 5.00e-61 224.00
IUUC-Pgr-103611 Puccinia graminis 73.15 6.00e-61 224.00
IUUC-Ptt-103971 Puccinia triticina 75.00 2.00e-46 175.00
IUUC-Pte-104378 Pyrenophora teres 81.21 9.00e-74 266.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 81.21 9.00e-74 266.00
IUUC-Rno-105772 Rattus norvegicus 69.33 2.00e-63 232.00
IUUC-Sce-106283 Saccharomyces cerevisiae 80.00 3.00e-75 271.00
IUUC-Sha-107650 Sarcophilus harrisii 68.67 8.00e-62 226.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 77.85 1.00e-62 229.00
IUUC-Spo-108073 Schizosaccharomyces pombe 77.18 3.00e-62 228.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 80.54 3.00e-73 265.00
IUUC-Smo-109036 Selaginella moellendorffii 64.67 7.00e-60 220.00
IUUC-Sit-110731 Setaria italica 64.00 3.00e-59 218.00
IUUC-Sly-111506 Solanum lycopersicum 64.00 2.00e-59 219.00
IUUC-Stu-112080 Solanum tuberosum 64.00 2.00e-59 219.00
IUUC-Sar-113429 Sorex araneus 69.33 3.00e-63 231.00
IUUC-Sbi-114289 Sorghum bicolor 64.00 3.00e-59 218.00
IUUC-Sre-115106 Sporisorium reilianum 70.47 2.00e-59 219.00
IUUC-Ssc-116265 Sus scrofa 69.13 4.00e-63 231.00
IUUC-Tgu-117383 Taeniopygia guttata 69.13 4.00e-63 231.00
IUUC-Tru-118576 Takifugu rubripes 69.13 7.00e-63 230.00
IUUC-Tsy-119000 Tarsius syrichta 69.33 3.00e-63 231.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.67 5.00e-63 230.00
IUUC-Tca-121827 Theobroma cacao 64.67 1.00e-59 219.00
IUUC-Tre-122002 Trichoderma reesei 81.88 5.00e-75 270.00
IUUC-Tvi-122331 Trichoderma virens 81.88 5.00e-75 270.00
IUUC-Tae-124461 Triticum aestivum 63.33 5.00e-59 218.00
IUUC-Tur-126866 Triticum urartu 62.00 4.00e-58 214.00
IUUC-Tme-127148 Tuber melanosporum 81.88 1.00e-74 269.00
IUUC-Tbe-127921 Tupaia belangeri 67.33 1.00e-58 216.00
IUUC-Ttr-129121 Tursiops truncatus 69.33 3.00e-63 231.00
IUUC-Uma-129561 Ustilago maydis 70.47 1.00e-59 219.00
IUUC-Vda-129711 Verticillium dahliae 82.55 1.00e-75 272.00
IUUC-Vpa-130570 Vicugna pacos 60.74 7.00e-48 180.00
IUUC-Vvi-131108 Vitis vinifera 64.00 6.00e-60 220.00
IUUC-Xtr-131824 Xenopus tropicalis 69.33 2.00e-63 231.00
IUUC-Xma-133937 Xiphophorus maculatus 69.13 4.00e-63 231.00
IUUC-Yli-134660 Yarrowia lipolytica 81.33 1.00e-74 269.00
IUUC-Zma-135584 Zea mays 62.67 5.00e-59 218.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved