• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Sly-111489
Ensembl Protein ID Solyc07g066650.2.1
UniProt Accession K4CHY8; K4CHY8_SOLLC
Protein Name Defective in cullin neddylation protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
Solyc07g066650.2 Solyc07g066650.2.1 Solyc07g066650.2.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 9.30e-84 280.9 56 242
UBD/Alpha-Helix/UBA 1.40e-06 29.0 11 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselkdeq 92
    + ++leel++rYkdp+ d+i+++g++ +c+d++vdp+di++Lvl+w+++aat+cefs++ef+ gl++lg+ds+ekl+ekl++++se+kde+
   Q: 56 DARRLEELYNRYKDPYADMILADGISLLCNDMQVDPQDIVMLVLSWHMKAATMCEFSKQEFIGGLQSLGIDSLEKLREKLPFMRSEMKDEH 146
    689**************************************************************************************** PP
   S: 93 kfkdiYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaWPvliDe 183
    kf++iY+faf++ak+kgqksl+ldtai +w+Ll+ae+e++l+++w++fL+ +++k+is+DtW +lLef++ +++ l nYd+egaWP+liDe
   Q: 147 KFREIYNFAFSWAKEKGQKSLALDTAIGMWQLLFAEKEWPLVEHWCQFLQARHNKAISRDTWSQLLEFARNVDPALTNYDAEGAWPYLIDE 237
    ******************************************************************************************* PP
   S: 184 fveyl 188
    fveyl
   Q: 238 FVEYL 242
    ***96 PP
   


   UBD/Alpha-Helix/UBA

   S: 5    dkleqlve.MGFdreealqaLraannnleaAveyLld 40
    dk++q++ +G +++ alqaL +++nle A + +++
   Q: 11 DKVQQFMTiTGASEKVALQALKVSDWNLEGAFDVFYS 47
    89*****************************998886 PP
   

Organism Solanum lycopersicum
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MQNKLGIGRR DKVQQFMTIT GASEKVALQA LKVSDWNLEG AFDVFYSQSQ VKSSADARRL 60
EELYNRYKDP YADMILADGI SLLCNDMQVD PQDIVMLVLS WHMKAATMCE FSKQEFIGGL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sly-111489|E3,DCUN1;UBD,UBA|Solanum lycopersicum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TGACTAATCA AAGCTAGATC CTATCAACAT TAGATTGGCG TCCAAATCCG GTTTCCTCAC 60
ACCTTATAGT CGTGGACCTT TTTTTCTGGC TTTTACTTAA AATAAAAGGA AAAAATAAGT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sly-111489|E3,DCUN1;UBD,UBA|Solanum lycopersicum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Gene Ontology

GO:0000151--C:ubiquitin ligase complex
GO:0097602--F:cullin family protein binding
GO:0031624--F:ubiquitin conjugating enzyme binding
GO:0032182--F:ubiquitin-like protein binding
GO:0051443--P:positive regulation of ubiquitin-protein transferase activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 75.30 6.00e-115 405.00
IUUC-Aml-001879 Ailuropoda melanoleuca 44.72 2.00e-60 224.00
IUUC-Atr-002697 Amborella trichopoda 85.59 8.00e-57 211.00
IUUC-Apl-003451 Anas platyrhynchos 43.78 2.00e-59 221.00
IUUC-Aca-005269 Anolis carolinensis 43.90 6.00e-59 220.00
IUUC-Aly-006285 Arabidopsis lyrata 68.02 3.00e-95 339.00
IUUC-Ath-007531 Arabidopsis thaliana 77.82 4.00e-117 412.00
IUUC-Ago-007806 Ashbya gossypii 25.00 1.00e-18 85.50
IUUC-Acl-008172 Aspergillus clavatus 26.59 1.00e-23 102.00
IUUC-Afl-008569 Aspergillus flavus 28.51 8.00e-30 123.00
IUUC-Afu-009005 Aspergillus fumigatus 27.06 8.00e-19 85.90
IUUC-Ani-009241 Aspergillus nidulans 23.10 6.00e-20 90.50
IUUC-Ang-009664 Aspergillus niger 28.46 6.00e-27 113.00
IUUC-Aor-009902 Aspergillus oryzae 29.25 2.00e-11 60.50
IUUC-Ate-010414 Aspergillus terreus 26.91 8.00e-28 116.00
IUUC-Ame-011763 Astyanax mexicanus 45.31 2.00e-61 227.00
IUUC-Bgr-011991 Blumeria graminis 28.37 2.00e-20 92.40
IUUC-Bta-013561 Bos taurus 43.53 5.00e-55 206.00
IUUC-Bci-013824 Botrytis cinerea 32.14 2.00e-30 125.00
IUUC-Bdi-014138 Brachypodium distachyon 76.11 3.00e-115 406.00
IUUC-Bol-015564 Brassica oleracea 78.54 4.00e-118 416.00
IUUC-Bra-017111 Brassica rapa 78.54 2.00e-118 417.00
IUUC-Cel-018441 Caenorhabditis elegans 33.94 5.00e-40 157.00
IUUC-Cja-019502 Callithrix jacchus 44.72 2.00e-60 224.00
IUUC-Cfa-020523 Canis familiaris 43.97 1.00e-55 208.00
IUUC-Cpo-022196 Cavia porcellus 44.31 5.00e-60 223.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 45.49 1.00e-63 235.00
IUUC-Csa-023551 Chlorocebus sabaeus 44.72 2.00e-60 224.00
IUUC-Cho-024373 Choloepus hoffmanni 44.31 1.00e-56 212.00
IUUC-Cin-025269 Ciona intestinalis 42.28 2.00e-58 217.00
IUUC-Csv-025976 Ciona savignyi 34.38 6.00e-35 139.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 28.49 2.00e-19 88.20
IUUC-Cne-026950 Cryptococcus neoformans 35.25 3.00e-37 147.00
IUUC-Cme-027199 Cyanidioschyzon merolae 30.20 2.00e-10 58.50
IUUC-Dre-028247 Danio rerio 44.90 8.00e-61 226.00
IUUC-Dno-028974 Dasypus novemcinctus 44.72 2.00e-60 224.00
IUUC-Dor-030143 Dipodomys ordii 43.50 2.00e-59 221.00
IUUC-Dse-031365 Dothistroma septosporum 27.02 7.00e-25 106.00
IUUC-Dme-032197 Drosophila melanogaster 41.00 1.00e-56 212.00
IUUC-Ete-032371 Echinops telfairi 44.72 2.00e-60 224.00
IUUC-Eca-033242 Equus caballus 44.72 2.00e-60 224.00
IUUC-Eeu-035317 Erinaceus europaeus 45.12 1.00e-60 225.00
IUUC-Fca-036061 Felis catus 44.72 2.00e-60 224.00
IUUC-Fal-036715 Ficedula albicollis 43.72 3.00e-59 220.00
IUUC-Fox-037884 Fusarium oxysporum 32.54 1.00e-14 72.00
IUUC-Fso-038150 Fusarium solani 25.94 2.00e-16 79.30
IUUC-Gmo-038750 Gadus morhua 45.16 9.00e-61 225.00
IUUC-Ggr-039959 Gaeumannomyces graminis 26.67 1.00e-15 77.80
IUUC-Gga-040935 Gallus gallus 44.31 6.00e-60 223.00
IUUC-Gac-041937 Gasterosteus aculeatus 44.90 1.00e-60 225.00
IUUC-Gma-043545 Glycine max 81.32 1.00e-125 441.00
IUUC-Ggo-044468 Gorilla gorilla 44.35 6.00e-59 219.00
IUUC-Hsa-046089 Homo sapiens 44.72 2.00e-60 224.00
IUUC-Hvu-047636 Hordeum vulgare 35.43 7.00e-20 89.40
IUUC-Itr-047902 Ictidomys tridecemlineatus 44.13 8.00e-59 219.00
IUUC-Kpa-049127 Komagataella pastoris 30.61 5.00e-29 120.00
IUUC-Lch-050600 Latimeria chalumnae 44.31 7.00e-61 226.00
IUUC-Lpe-051540 Leersia perrieri 76.71 7.00e-120 422.00
IUUC-Loc-052509 Lepisosteus oculatus 45.12 3.00e-60 224.00
IUUC-Lma-053103 Leptosphaeria maculans 28.23 5.00e-26 110.00
IUUC-Laf-053527 Loxodonta africana 44.31 3.00e-60 223.00
IUUC-Mcc-054700 Macaca mulatta 42.28 4.00e-58 217.00
IUUC-Meu-056791 Macropus eugenii 37.96 1.00e-43 169.00
IUUC-Mor-056909 Magnaporthe oryzae 25.87 3.00e-21 94.70
IUUC-Mpo-057299 Magnaporthe poae 25.65 2.00e-19 88.60
IUUC-Mtr-057964 Medicago truncatula 81.32 2.00e-126 443.00
IUUC-Mla-058990 Melampsora laricipopulina 26.12 7.00e-17 80.90
IUUC-Mga-060072 Meleagris gallopavo 44.13 2.00e-59 221.00
IUUC-Mvi-060312 Microbotryum violaceum 32.54 2.00e-38 151.00
IUUC-Mmr-060851 Microcebus murinus 44.72 3.00e-60 224.00
IUUC-Mdo-063074 Monodelphis domestica 44.76 1.00e-60 228.00
IUUC-Mmu-063816 Mus musculus 44.31 5.00e-60 223.00
IUUC-Mac-065016 Musa acuminata 84.15 2.00e-93 333.00
IUUC-Mpu-066870 Mustela putorius furo 43.97 1.00e-55 208.00
IUUC-Mlu-067701 Myotis lucifugus 44.31 2.00e-59 221.00
IUUC-Nfi-068610 Neosartorya fischeri 27.65 7.00e-19 86.30
IUUC-Ncr-068780 Neurospora crassa 24.07 2.00e-16 79.30
IUUC-Nle-069291 Nomascus leucogenys 44.72 2.00e-60 224.00
IUUC-Opr-070682 Ochotona princeps 40.20 1.00e-43 169.00
IUUC-Ont-071408 Oreochromis niloticus 44.72 4.00e-61 226.00
IUUC-Oan-073031 Ornithorhynchus anatinus 45.12 1.00e-60 225.00
IUUC-Ocu-074648 Oryctolagus cuniculus 44.72 2.00e-60 224.00
IUUC-Oba-074993 Oryza barthii 77.02 1.00e-119 421.00
IUUC-Obr-076341 Oryza brachyantha 75.81 4.00e-118 416.00
IUUC-Ogl-077099 Oryza glaberrima 77.02 1.00e-119 421.00
IUUC-Ogu-078285 Oryza glumaepatula 77.82 1.00e-120 424.00
IUUC-Oin-079441 Oryza indica 77.42 3.00e-120 423.00
IUUC-Olo-081037 Oryza longistaminata 77.42 3.00e-120 423.00
IUUC-Ome-081357 Oryza meridionalis 77.42 3.00e-120 423.00
IUUC-Oni-082632 Oryza nivara 77.42 6.00e-120 422.00
IUUC-Opu-083351 Oryza punctata 77.35 8.00e-114 401.00
IUUC-Oru-084306 Oryza rufipogon 77.42 3.00e-120 423.00
IUUC-Osa-085307 Oryza sativa 77.42 3.00e-120 423.00
IUUC-Ola-086868 Oryzias latipes 44.19 3.00e-61 227.00
IUUC-Olu-087646 Ostreococcus lucimarinus 44.53 6.00e-54 203.00
IUUC-Oga-089015 Otolemur garnettii 44.31 9.00e-60 222.00
IUUC-Oar-090405 Ovis aries 44.31 9.00e-60 222.00
IUUC-Ptr-090735 Pan troglodytes 44.72 2.00e-60 224.00
IUUC-Pan-092825 Papio anubis 42.68 2.00e-58 218.00
IUUC-Psi-093110 Pelodiscus sinensis 42.67 3.00e-54 204.00
IUUC-Pma-094196 Petromyzon marinus 38.42 2.00e-42 165.00
IUUC-Pno-095145 Phaeosphaeria nodorum 30.30 5.00e-22 97.40
IUUC-Ppa-095306 Physcomitrella patens 76.52 5.00e-117 412.00
IUUC-Pfo-096774 Poecilia formosa 45.34 4.00e-62 230.00
IUUC-Pab-098197 Pongo abelii 40.82 1.00e-53 202.00
IUUC-Pop-098821 Populus trichocarpa 85.25 2.00e-61 226.00
IUUC-Pca-100218 Procavia capensis 43.50 7.00e-59 219.00
IUUC-Ppe-102032 Prunus persica 84.62 6.00e-128 448.00
IUUC-Pva-102691 Pteropus vampyrus 43.09 7.00e-59 219.00
IUUC-Pgr-103633 Puccinia graminis 27.70 1.00e-21 96.30
IUUC-Ptt-103979 Puccinia triticina 33.33 2.00e-04 39.70
IUUC-Pyt-104428 Pyrenophora triticirepentis 28.29 6.00e-22 96.70
IUUC-Rno-105554 Rattus norvegicus 44.72 3.00e-60 224.00
IUUC-Sce-106358 Saccharomyces cerevisiae 23.19 2.00e-18 85.10
IUUC-Sha-106888 Sarcophilus harrisii 44.72 2.00e-60 224.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.46 5.00e-22 97.10
IUUC-Spo-108207 Schizosaccharomyces pombe 33.02 1.00e-24 105.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 29.80 4.00e-29 120.00
IUUC-Smo-108750 Selaginella moellendorffii 66.67 3.00e-94 336.00
IUUC-Sit-110052 Setaria italica 77.60 4.00e-120 422.00
IUUC-Stu-112517 Solanum tuberosum 67.49 1.00e-103 368.00
IUUC-Sar-113509 Sorex araneus 47.09 4.00e-42 163.00
IUUC-Sbi-114082 Sorghum bicolor 76.83 4.00e-118 416.00
IUUC-Sre-115221 Sporisorium reilianum 25.26 9.00e-24 103.00
IUUC-Ssc-115547 Sus scrofa 44.72 2.00e-60 224.00
IUUC-Tgu-117147 Taeniopygia guttata 44.31 7.00e-60 223.00
IUUC-Tru-117740 Takifugu rubripes 45.12 6.00e-62 229.00
IUUC-Tsy-119599 Tarsius syrichta 44.72 2.00e-60 224.00
IUUC-Tni-120542 Tetraodon nigroviridis 45.23 8.00e-60 222.00
IUUC-Tca-121033 Theobroma cacao 84.82 1.00e-133 468.00
IUUC-Tre-121986 Trichoderma reesei 23.67 2.00e-20 92.00
IUUC-Tvi-122607 Trichoderma virens 27.95 2.00e-25 108.00
IUUC-Tae-125740 Triticum aestivum 64.58 5.00e-109 386.00
IUUC-Tur-126375 Triticum urartu 58.62 7.00e-106 376.00
IUUC-Tme-126878 Tuber melanosporum 33.33 7.00e-36 143.00
IUUC-Tbe-127429 Tupaia belangeri 40.70 5.00e-44 170.00
IUUC-Ttr-129086 Tursiops truncatus 41.46 1.00e-52 198.00
IUUC-Uma-129364 Ustilago maydis 26.25 7.00e-29 120.00
IUUC-Vda-129929 Verticillium dahliae 29.02 1.00e-18 87.00
IUUC-Vpa-130048 Vicugna pacos 39.84 1.00e-47 182.00
IUUC-Vvi-130834 Vitis vinifera 82.88 4.00e-130 456.00
IUUC-Xtr-131888 Xenopus tropicalis 44.94 2.00e-61 228.00
IUUC-Xma-134122 Xiphophorus maculatus 43.72 3.00e-61 227.00
IUUC-Yli-134595 Yarrowia lipolytica 31.25 5.00e-32 130.00
IUUC-Zma-135642 Zea mays 77.24 1.00e-117 414.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved