• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • miRecords
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • Drug & target
    • TTD
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Oga-088304
Ensembl Protein ID ENSOGAP00000008296.2
UniProt Accession H0X073; H0X073_OTOGA
Genbank Protein ID ENSOGAP00000008296
Protein Name Uncharacterized protein
Genbank Nucleotide ID AAQR03002110
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSOGAG00000009264.2 ENSOGAT00000009267.2 ENSOGAP00000008296.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 1.80e-68 228.8 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk+ skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp+rg+tynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMASKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGEEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Otolemur garnettii
Protein Sequence
(Fasta)
MAVSESQLKK MASKYKYRDL TVRETVNVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP 60
VPYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Oga-088304|UBD,UBD_UEV|Otolemur garnettii
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGTGTGTTCT TGTGTGGGGC GGCCTGGGGC AGCCCTGAAG CGGCTGACCC TCTGCCTGCA 60
GGGACGAGAG TCTCGAGGCG GCCGTCATGG CGGTGTCGGA GAGCCAGCTC AAGAAAATGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Oga-088304|UBD,UBD_UEV|Otolemur garnettii
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 27.73 4.00e-27 115.00
IUUC-Aml-002415 Ailuropoda melanoleuca 97.44 0.00e+00 728.00
IUUC-Atr-002875 Amborella trichopoda 29.75 3.00e-38 152.00
IUUC-Apl-003473 Anas platyrhynchos 88.52 0.00e+00 688.00
IUUC-Aca-004573 Anolis carolinensis 90.31 0.00e+00 672.00
IUUC-Aly-006164 Arabidopsis lyrata 44.12 6.00e-22 98.60
IUUC-Ath-006575 Arabidopsis thaliana 31.17 3.00e-32 132.00
IUUC-Ago-007755 Ashbya gossypii 25.20 1.00e-05 44.30
IUUC-Acl-008218 Aspergillus clavatus 38.76 2.00e-25 110.00
IUUC-Afl-008597 Aspergillus flavus 39.10 2.00e-25 110.00
IUUC-Afu-009017 Aspergillus fumigatus 37.98 2.00e-23 103.00
IUUC-Ani-009468 Aspergillus nidulans 38.64 4.00e-21 96.30
IUUC-Ang-009755 Aspergillus niger 36.51 2.00e-22 101.00
IUUC-Aor-010072 Aspergillus oryzae 38.76 4.00e-25 109.00
IUUC-Ate-010400 Aspergillus terreus 37.98 6.00e-25 108.00
IUUC-Ame-011620 Astyanax mexicanus 80.26 0.00e+00 637.00
IUUC-Bgr-012136 Blumeria graminis 35.77 5.00e-24 105.00
IUUC-Bta-012557 Bos taurus 97.19 0.00e+00 746.00
IUUC-Bci-013881 Botrytis cinerea 37.41 3.00e-26 113.00
IUUC-Bdi-014325 Brachypodium distachyon 32.11 1.00e-14 73.60
IUUC-Bol-016308 Brassica oleracea 41.60 2.00e-26 114.00
IUUC-Bra-017442 Brassica rapa 42.37 3.00e-24 106.00
IUUC-Cel-018697 Caenorhabditis elegans 49.61 2.00e-37 150.00
IUUC-Cja-018963 Callithrix jacchus 91.33 0.00e+00 719.00
IUUC-Cfa-020472 Canis familiaris 97.44 0.00e+00 726.00
IUUC-Cpo-022001 Cavia porcellus 98.47 0.00e+00 734.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 30.08 2.00e-31 130.00
IUUC-Csa-023959 Chlorocebus sabaeus 97.95 0.00e+00 702.00
IUUC-Cho-024389 Choloepus hoffmanni 56.36 4.00e-38 152.00
IUUC-Cin-025688 Ciona intestinalis 44.53 3.00e-99 355.00
IUUC-Cne-026904 Cryptococcus neoformans 30.56 1.00e-14 74.70
IUUC-Cme-027280 Cyanidioschyzon merolae 39.09 1.00e-17 84.30
IUUC-Dre-027913 Danio rerio 80.51 4.00e-175 607.00
IUUC-Dno-029672 Dasypus novemcinctus 97.19 0.00e+00 737.00
IUUC-Dor-030175 Dipodomys ordii 97.50 3.00e-93 335.00
IUUC-Dse-031375 Dothistroma septosporum 30.29 2.00e-23 103.00
IUUC-Dme-031736 Drosophila melanogaster 47.36 2.00e-96 345.00
IUUC-Ete-032343 Echinops telfairi 92.58 0.00e+00 700.00
IUUC-Eca-033926 Equus caballus 97.70 0.00e+00 724.00
IUUC-Eeu-034940 Erinaceus europaeus 90.28 0.00e+00 715.00
IUUC-Fca-035491 Felis catus 96.93 0.00e+00 710.00
IUUC-Fal-037508 Ficedula albicollis 90.82 0.00e+00 686.00
IUUC-Fox-037937 Fusarium oxysporum 32.31 2.00e-21 97.10
IUUC-Fso-038091 Fusarium solani 36.03 4.00e-25 109.00
IUUC-Gmo-039427 Gadus morhua 78.72 7.00e-170 589.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.31 4.00e-25 109.00
IUUC-Gga-040998 Gallus gallus 89.54 0.00e+00 708.00
IUUC-Gac-041356 Gasterosteus aculeatus 80.46 0.00e+00 638.00
IUUC-Gma-043566 Glycine max 39.68 2.00e-25 109.00
IUUC-Ggo-044967 Gorilla gorilla 97.95 0.00e+00 702.00
IUUC-Hsa-046686 Homo sapiens 97.95 0.00e+00 702.00
IUUC-Hvu-047430 Hordeum vulgare 27.73 5.00e-27 115.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 97.77 4.00e-110 389.00
IUUC-Kpa-049287 Komagataella pastoris 25.54 2.00e-28 120.00
IUUC-Lch-050597 Latimeria chalumnae 86.73 0.00e+00 703.00
IUUC-Lpe-051090 Leersia perrieri 38.02 2.00e-20 93.60
IUUC-Loc-052399 Lepisosteus oculatus 81.07 2.00e-177 614.00
IUUC-Lma-053249 Leptosphaeria maculans 29.82 9.00e-14 72.00
IUUC-Laf-053766 Loxodonta africana 97.95 0.00e+00 731.00
IUUC-Mcc-055641 Macaca mulatta 97.95 0.00e+00 702.00
IUUC-Meu-055919 Macropus eugenii 90.49 5.00e-170 590.00
IUUC-Mor-056970 Magnaporthe oryzae 38.46 3.00e-24 106.00
IUUC-Mpo-057345 Magnaporthe poae 36.92 5.00e-23 102.00
IUUC-Mtr-058436 Medicago truncatula 30.62 5.00e-35 141.00
IUUC-Mla-059037 Melampsora laricipopulina 35.86 3.00e-25 109.00
IUUC-Mga-059263 Meleagris gallopavo 88.83 0.00e+00 687.00
IUUC-Mvi-060463 Microbotryum violaceum 29.56 1.00e-17 84.70
IUUC-Mmr-060915 Microcebus murinus 97.70 0.00e+00 726.00
IUUC-Mdo-062449 Monodelphis domestica 94.37 0.00e+00 689.00
IUUC-Mmu-063151 Mus musculus 94.88 0.00e+00 704.00
IUUC-Mac-065581 Musa acuminata 36.43 7.00e-22 97.80
IUUC-Mpu-066621 Mustela putorius furo 97.44 0.00e+00 728.00
IUUC-Mlu-067336 Myotis lucifugus 97.19 0.00e+00 713.00
IUUC-Nfi-068530 Neosartorya fischeri 38.76 2.00e-23 104.00
IUUC-Ncr-068785 Neurospora crassa 36.03 1.00e-24 108.00
IUUC-Nle-069972 Nomascus leucogenys 97.95 0.00e+00 702.00
IUUC-Opr-071150 Ochotona princeps 68.80 2.00e-124 438.00
IUUC-Ont-071366 Oreochromis niloticus 78.97 0.00e+00 636.00
IUUC-Oan-073290 Ornithorhynchus anatinus 93.04 1.00e-105 375.00
IUUC-Ocu-074351 Oryctolagus cuniculus 98.21 0.00e+00 731.00
IUUC-Oba-075338 Oryza barthii 37.14 2.00e-11 63.20
IUUC-Obr-076135 Oryza brachyantha 26.70 5.00e-29 121.00
IUUC-Ogl-077182 Oryza glaberrima 36.28 3.00e-17 82.40
IUUC-Ogu-078281 Oryza glumaepatula 27.99 5.00e-26 111.00
IUUC-Oin-079068 Oryza indica 36.28 8.00e-17 81.60
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.40
IUUC-Ome-081781 Oryza meridionalis 26.20 5.00e-18 85.50
IUUC-Oni-082517 Oryza nivara 25.93 1.00e-16 80.90
IUUC-Opu-084101 Oryza punctata 36.28 3.00e-17 82.80
IUUC-Oru-084556 Oryza rufipogon 36.28 4.00e-17 82.40
IUUC-Osa-086264 Oryza sativa 36.28 4.00e-17 82.40
IUUC-Ola-087252 Oryzias latipes 93.29 2.00e-69 254.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.17 6.00e-15 75.10
IUUC-Oar-089734 Ovis aries 97.19 0.00e+00 746.00
IUUC-Ptr-091476 Pan troglodytes 97.95 0.00e+00 702.00
IUUC-Pan-092341 Papio anubis 97.95 0.00e+00 702.00
IUUC-Psi-093470 Pelodiscus sinensis 92.47 0.00e+00 675.00
IUUC-Pma-094143 Petromyzon marinus 64.36 7.00e-133 466.00
IUUC-Pno-095069 Phaeosphaeria nodorum 31.93 4.00e-14 72.80
IUUC-Ppa-095933 Physcomitrella patens 30.71 1.00e-39 156.00
IUUC-Pfo-096321 Poecilia formosa 82.86 4.00e-176 610.00
IUUC-Pab-098527 Pongo abelii 97.17 5.00e-180 623.00
IUUC-Pop-099323 Populus trichocarpa 27.93 9.00e-38 150.00
IUUC-Pca-101044 Procavia capensis 79.54 4.00e-158 550.00
IUUC-Ppe-101458 Prunus persica 41.67 3.00e-27 115.00
IUUC-Pva-103014 Pteropus vampyrus 86.96 2.00e-173 601.00
IUUC-Pgr-103615 Puccinia graminis 37.30 4.00e-20 92.80
IUUC-Ptt-103826 Puccinia triticina 40.20 1.00e-16 81.30
IUUC-Pte-104171 Pyrenophora teres 35.29 3.00e-21 96.70
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.50
IUUC-Rno-105957 Rattus norvegicus 93.86 0.00e+00 697.00
IUUC-Sce-106262 Saccharomyces cerevisiae 24.20 1.00e-18 87.00
IUUC-Sha-107607 Sarcophilus harrisii 95.13 3.00e-176 610.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.10e-02 34.70
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.29 2.00e-25 110.00
IUUC-Smo-108973 Selaginella moellendorffii 39.47 5.00e-21 95.10
IUUC-Sly-111373 Solanum lycopersicum 36.51 7.00e-24 104.00
IUUC-Stu-112844 Solanum tuberosum 35.71 5.00e-23 102.00
IUUC-Sar-113653 Sorex araneus 81.49 2.00e-175 608.00
IUUC-Sbi-114390 Sorghum bicolor 26.61 7.00e-30 124.00
IUUC-Sre-115200 Sporisorium reilianum 37.50 5.00e-24 105.00
IUUC-Ssc-115888 Sus scrofa 98.24 1.00e-112 398.00
IUUC-Tgu-117506 Taeniopygia guttata 89.85 0.00e+00 695.00
IUUC-Tru-118063 Takifugu rubripes 79.08 2.00e-170 591.00
IUUC-Tsy-118851 Tarsius syrichta 74.71 7.00e-144 503.00
IUUC-Tni-120010 Tetraodon nigroviridis 79.13 2.00e-169 588.00
IUUC-Tca-121182 Theobroma cacao 38.89 2.00e-22 99.80
IUUC-Tre-122040 Trichoderma reesei 36.15 5.00e-22 99.00
IUUC-Tvi-122660 Trichoderma virens 39.71 7.00e-26 111.00
IUUC-Tae-124561 Triticum aestivum 27.73 4.00e-27 115.00
IUUC-Tur-126651 Triticum urartu 38.02 1.00e-20 94.00
IUUC-Tme-127184 Tuber melanosporum 47.32 8.00e-26 112.00
IUUC-Tbe-127894 Tupaia belangeri 82.50 4.00e-89 321.00
IUUC-Ttr-128264 Tursiops truncatus 89.51 0.00e+00 705.00
IUUC-Uma-129407 Ustilago maydis 36.18 2.00e-24 107.00
IUUC-Vda-130002 Verticillium dahliae 29.73 8.00e-16 78.60
IUUC-Vpa-130156 Vicugna pacos 96.50 1.00e-96 346.00
IUUC-Vvi-131062 Vitis vinifera 29.58 5.00e-34 138.00
IUUC-Xtr-132332 Xenopus tropicalis 82.44 3.00e-64 236.00
IUUC-Xma-133186 Xiphophorus maculatus 82.61 1.00e-179 622.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 7.00e-13 68.20
IUUC-Zma-135391 Zea mays 36.13 5.00e-20 92.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved