• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • Disease
    • ClinVar
    • GWASdb
    • GWAS Central
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Nfi-068580
Ensembl Protein ID CADNFIAP00004770
UniProt Accession A1DPD2; A1DPD2_NEOFI
Genbank Protein ID EAW16653.1
Protein Name Ubiquitin conjugating enzyme (UbcB), putative
Genbank Nucleotide ID DS027698
Gene Name NFIA_060090
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CADNFIAG00004898 CADNFIAT00004898 CADNFIAP00004770
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 6.60e-52 174.1 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWs 93
    Rl++++k++++dpp+g+sa+pv + ++++w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP vkf++++fhPnvy +G++Cl+il+ ++Ws
   Q: 8 RLMRDFKRMQTDPPAGVSASPVAD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQ--NRWS 97
    9***********************.9************************************************************9..**** PP
   S: 94 palsvesvllsiqsllaepnpesplneeaaellkknreeykkkvre 139
    p+++v+ +l+siqsll++pn++sp+n+ea++l+k+nr+ey k+vre
   Q: 98 PTYDVAAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRE 143
    *******************************************985 PP
   

Organism Neosartorya fischeri
Protein Sequence
(Fasta)
MSTSARRRLM RDFKRMQTDP PAGVSASPVA DNVMTWNAVI IGPADTPFED GTFRLVMHFE 60
EQYPNKPPGV KFISQMFHPN VYGTGELCLD ILQNRWSPTY DVAAILTSIQ SLLNDPNTSS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Nfi-068580|E2,E2/UBC|Neosartorya fischeri
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCTACTT CTGCCCGCCG TCGTCTCATG CGTGACTTCA AGGTACGTGA TTATTGAAGG 60
CCATTGACTC TGACTCAGTT CGTTGTCACC TCTTTTCTCC ATGTATTTCT ATTTCGTCCT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Nfi-068580|E2,E2/UBC|Neosartorya fischeri
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG nfi:NFIA_060090
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 64.43 7.00e-60 220.00
IUUC-Aml-002120 Ailuropoda melanoleuca 68.87 4.00e-64 234.00
IUUC-Atr-002623 Amborella trichopoda 66.44 4.00e-61 224.00
IUUC-Apl-004063 Anas platyrhynchos 61.49 1.00e-53 199.00
IUUC-Aca-005001 Anolis carolinensis 68.21 6.00e-64 234.00
IUUC-Aly-005584 Arabidopsis lyrata 65.77 1.00e-60 223.00
IUUC-Ath-007149 Arabidopsis thaliana 65.77 1.00e-60 223.00
IUUC-Ago-007745 Ashbya gossypii 76.67 7.00e-71 257.00
IUUC-Acl-008139 Aspergillus clavatus 99.34 1.00e-88 316.00
IUUC-Afl-008551 Aspergillus flavus 100.00 5.00e-89 317.00
IUUC-Afu-008980 Aspergillus fumigatus 100.00 5.00e-89 317.00
IUUC-Ang-009554 Aspergillus niger 100.00 5.00e-89 317.00
IUUC-Aor-010242 Aspergillus oryzae 100.00 5.00e-89 317.00
IUUC-Ate-010390 Aspergillus terreus 100.00 5.00e-89 317.00
IUUC-Ame-010743 Astyanax mexicanus 69.54 3.00e-64 234.00
IUUC-Bgr-012039 Blumeria graminis 93.38 2.00e-75 272.00
IUUC-Bta-012840 Bos taurus 68.87 4.00e-64 234.00
IUUC-Bci-013919 Botrytis cinerea 94.04 4.00e-84 301.00
IUUC-Bdi-015010 Brachypodium distachyon 66.44 8.00e-61 223.00
IUUC-Bol-016245 Brassica oleracea 65.77 9.00e-61 223.00
IUUC-Bra-016809 Brassica rapa 65.77 1.00e-60 224.00
IUUC-Cel-018244 Caenorhabditis elegans 69.80 1.00e-64 237.00
IUUC-Cja-018783 Callithrix jacchus 68.87 4.00e-64 234.00
IUUC-Cfa-020244 Canis familiaris 68.87 4.00e-64 234.00
IUUC-Cpo-021323 Cavia porcellus 69.54 3.00e-64 235.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.44 2.00e-51 192.00
IUUC-Csa-023588 Chlorocebus sabaeus 68.87 4.00e-64 234.00
IUUC-Cho-024773 Choloepus hoffmanni 54.30 3.00e-44 169.00
IUUC-Cin-025537 Ciona intestinalis 68.46 2.00e-53 199.00
IUUC-Csv-025846 Ciona savignyi 68.46 7.00e-57 210.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 94.70 1.00e-84 302.00
IUUC-Cne-026864 Cryptococcus neoformans 70.47 2.00e-64 236.00
IUUC-Cme-027284 Cyanidioschyzon merolae 63.33 2.00e-50 189.00
IUUC-Dre-027775 Danio rerio 68.87 2.00e-64 235.00
IUUC-Dno-029661 Dasypus novemcinctus 68.87 4.00e-64 234.00
IUUC-Dor-030452 Dipodomys ordii 66.18 1.00e-55 206.00
IUUC-Dse-031487 Dothistroma septosporum 97.35 1.00e-87 313.00
IUUC-Dme-031863 Drosophila melanogaster 70.20 7.00e-64 234.00
IUUC-Ete-032595 Echinops telfairi 66.89 2.00e-62 229.00
IUUC-Eca-033377 Equus caballus 68.87 4.00e-64 234.00
IUUC-Eeu-035191 Erinaceus europaeus 54.90 5.00e-44 167.00
IUUC-Fca-036581 Felis catus 68.87 4.00e-64 234.00
IUUC-Fal-037474 Ficedula albicollis 67.80 7.00e-49 183.00
IUUC-Fox-037808 Fusarium oxysporum 94.70 2.00e-84 302.00
IUUC-Fso-038232 Fusarium solani 94.04 6.00e-84 300.00
IUUC-Gmo-038517 Gadus morhua 68.87 4.00e-64 234.00
IUUC-Ggr-039875 Gaeumannomyces graminis 95.33 1.00e-84 302.00
IUUC-Gga-040588 Gallus gallus 68.87 4.00e-64 234.00
IUUC-Gac-042471 Gasterosteus aculeatus 68.87 2.00e-64 236.00
IUUC-Gma-043865 Glycine max 66.44 2.00e-61 226.00
IUUC-Ggo-044896 Gorilla gorilla 68.87 4.00e-64 234.00
IUUC-Hsa-046383 Homo sapiens 68.87 4.00e-64 234.00
IUUC-Hvu-047054 Hordeum vulgare 64.43 7.00e-60 220.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 68.87 4.00e-64 234.00
IUUC-Kpa-049225 Komagataella pastoris 82.55 2.00e-74 269.00
IUUC-Lch-049964 Latimeria chalumnae 68.87 4.00e-64 234.00
IUUC-Lpe-051301 Leersia perrieri 66.44 5.00e-61 224.00
IUUC-Loc-051962 Lepisosteus oculatus 70.20 8.00e-65 237.00
IUUC-Laf-053680 Loxodonta africana 68.87 4.00e-64 234.00
IUUC-Mcc-054819 Macaca mulatta 68.87 3.00e-64 235.00
IUUC-Meu-056231 Macropus eugenii 68.87 4.00e-64 234.00
IUUC-Mor-057087 Magnaporthe oryzae 96.30 5.00e-76 274.00
IUUC-Mpo-057498 Magnaporthe poae 95.33 8.00e-85 304.00
IUUC-Mtr-058305 Medicago truncatula 66.44 3.00e-61 225.00
IUUC-Mla-058876 Melampsora laricipopulina 74.83 2.00e-63 232.00
IUUC-Mga-059863 Meleagris gallopavo 65.47 2.00e-56 209.00
IUUC-Mvi-060330 Microbotryum violaceum 75.50 1.00e-62 229.00
IUUC-Mmr-060630 Microcebus murinus 68.87 4.00e-64 234.00
IUUC-Mdo-062292 Monodelphis domestica 68.87 4.00e-64 234.00
IUUC-Mmu-063680 Mus musculus 68.87 4.00e-64 234.00
IUUC-Mac-064774 Musa acuminata 66.44 6.00e-61 224.00
IUUC-Mpu-065803 Mustela putorius furo 68.87 4.00e-64 234.00
IUUC-Mlu-067147 Myotis lucifugus 68.87 4.00e-64 234.00
IUUC-Ncr-068913 Neurospora crassa 94.70 1.00e-84 302.00
IUUC-Nle-069121 Nomascus leucogenys 68.87 4.00e-64 234.00
IUUC-Opr-070935 Ochotona princeps 68.87 4.00e-64 234.00
IUUC-Ont-071335 Oreochromis niloticus 68.87 2.00e-64 236.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.70 5.00e-57 211.00
IUUC-Ocu-074550 Oryctolagus cuniculus 68.87 7.00e-64 234.00
IUUC-Oba-075896 Oryza barthii 66.44 8.00e-61 223.00
IUUC-Obr-076770 Oryza brachyantha 67.11 3.00e-61 225.00
IUUC-Ogl-077116 Oryza glaberrima 66.44 5.00e-61 224.00
IUUC-Ogu-078696 Oryza glumaepatula 66.44 5.00e-61 224.00
IUUC-Oin-079099 Oryza indica 66.44 5.00e-61 224.00
IUUC-Olo-081018 Oryza longistaminata 55.76 6.00e-51 191.00
IUUC-Ome-081285 Oryza meridionalis 66.44 5.00e-61 224.00
IUUC-Oni-082088 Oryza nivara 66.44 5.00e-61 224.00
IUUC-Opu-083310 Oryza punctata 66.44 5.00e-61 224.00
IUUC-Oru-084449 Oryza rufipogon 66.44 5.00e-61 224.00
IUUC-Osa-085923 Oryza sativa 66.44 5.00e-61 224.00
IUUC-Ola-087160 Oryzias latipes 68.87 2.00e-64 236.00
IUUC-Olu-087830 Ostreococcus lucimarinus 66.44 2.00e-53 199.00
IUUC-Oga-088659 Otolemur garnettii 68.87 4.00e-64 234.00
IUUC-Oar-090141 Ovis aries 68.87 4.00e-64 234.00
IUUC-Ptr-091305 Pan troglodytes 68.87 4.00e-64 234.00
IUUC-Pan-092511 Papio anubis 68.87 4.00e-64 234.00
IUUC-Psi-094094 Pelodiscus sinensis 68.87 4.00e-64 234.00
IUUC-Pma-094376 Petromyzon marinus 68.87 9.00e-64 233.00
IUUC-Pno-094935 Phaeosphaeria nodorum 94.04 8.00e-85 303.00
IUUC-Ppa-095689 Physcomitrella patens 68.50 2.00e-52 196.00
IUUC-Pfo-096656 Poecilia formosa 68.21 6.00e-64 234.00
IUUC-Pab-097972 Pongo abelii 68.87 4.00e-64 234.00
IUUC-Pop-099734 Populus trichocarpa 66.44 2.00e-55 206.00
IUUC-Pca-100906 Procavia capensis 63.58 2.00e-57 212.00
IUUC-Ppe-101949 Prunus persica 66.44 5.00e-61 225.00
IUUC-Pva-102380 Pteropus vampyrus 68.21 5.00e-62 228.00
IUUC-Pgr-103611 Puccinia graminis 74.83 1.00e-63 233.00
IUUC-Ptt-103971 Puccinia triticina 77.97 4.00e-49 184.00
IUUC-Pte-104378 Pyrenophora teres 95.36 1.00e-85 306.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 95.36 1.00e-85 306.00
IUUC-Rno-105772 Rattus norvegicus 68.87 3.00e-64 235.00
IUUC-Sce-106283 Saccharomyces cerevisiae 76.67 6.00e-71 257.00
IUUC-Sha-107650 Sarcophilus harrisii 68.21 8.00e-63 230.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 83.33 9.00e-68 246.00
IUUC-Spo-108073 Schizosaccharomyces pombe 82.67 1.00e-67 246.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 94.04 4.00e-84 301.00
IUUC-Smo-109512 Selaginella moellendorffii 67.11 2.00e-61 226.00
IUUC-Sit-110731 Setaria italica 66.44 5.00e-61 224.00
IUUC-Sly-111506 Solanum lycopersicum 66.44 3.00e-61 225.00
IUUC-Stu-112080 Solanum tuberosum 66.44 3.00e-61 225.00
IUUC-Sar-113429 Sorex araneus 68.87 4.00e-64 234.00
IUUC-Sbi-114289 Sorghum bicolor 66.44 5.00e-61 224.00
IUUC-Sre-115106 Sporisorium reilianum 73.51 2.00e-62 229.00
IUUC-Ssc-116265 Sus scrofa 68.87 4.00e-64 234.00
IUUC-Tgu-117383 Taeniopygia guttata 68.87 4.00e-64 234.00
IUUC-Tru-118576 Takifugu rubripes 68.21 2.00e-63 232.00
IUUC-Tsy-119000 Tarsius syrichta 68.87 4.00e-64 234.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.21 1.00e-63 233.00
IUUC-Tca-121827 Theobroma cacao 67.11 2.00e-61 225.00
IUUC-Tre-122002 Trichoderma reesei 93.38 7.00e-84 300.00
IUUC-Tvi-122331 Trichoderma virens 93.38 7.00e-84 300.00
IUUC-Tae-124461 Triticum aestivum 65.77 2.00e-60 223.00
IUUC-Tur-126866 Triticum urartu 65.10 3.00e-60 222.00
IUUC-Tme-127148 Tuber melanosporum 94.67 3.00e-85 305.00
IUUC-Tbe-127921 Tupaia belangeri 66.89 1.00e-59 219.00
IUUC-Ttr-129121 Tursiops truncatus 68.87 4.00e-64 234.00
IUUC-Uma-129561 Ustilago maydis 73.51 8.00e-63 230.00
IUUC-Vda-129711 Verticillium dahliae 94.70 1.00e-84 302.00
IUUC-Vpa-130570 Vicugna pacos 61.03 6.00e-50 187.00
IUUC-Vvi-131108 Vitis vinifera 66.44 1.00e-61 226.00
IUUC-Xtr-131824 Xenopus tropicalis 68.87 3.00e-64 235.00
IUUC-Xma-133667 Xiphophorus maculatus 68.87 2.00e-64 236.00
IUUC-Yli-134660 Yarrowia lipolytica 85.43 5.00e-78 281.00
IUUC-Zma-135584 Zea mays 65.10 2.00e-60 222.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved