• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • Disease
    • ClinVar
    • GWASdb
    • GWAS Central
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Spo-108073
UUCD1 version UUC-ScP-00257
Ensembl Protein ID SPAC18B11.07c.1:pep
UniProt Accession P23566; UBC2_SCHPO
Genbank Protein ID CAA37340.1; CAA90592.1
Protein Name Ubiquitin-conjugating enzyme E2 2; E2 ubiquitin-conjugating enzyme 2; RAD6 homolog; Ubiquitin carrier protein 2; Ubiquitin-protein ligase 2
Genbank Nucleotide ID X53252; CU329670
Gene Name rhp6; ubc2; SPAC18B11.07c
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
SPAC18B11.07c SPAC18B11.07c.1 SPAC18B11.07c.1:pep
Annotation
mRNA Expression
GEO
Protein-protein Interaction
iRefIndexMentha
Protein Expression/Proteomics
Status Reviewed
Details
Family Domain References (PMIDs)
E2/UBC E2_UBC 17456468
Classification
Family E-value Score Start End
E2/UBC 1.00e-52 175.7 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate N/A
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeee 90
    Rl++++k++++dpp+g+sa+pv++ +++ w+++i+Gp+dtp+e+g+Fkl ++f+e+YP kPP vkf++++fhPnvy+nG++Cl+il+ +
   Q: 8 RLMRDFKRMQQDPPAGVSASPVSD-NVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQ--N 94
    9***********************.9************************************************************9..* PP
   S: 91 kWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    +Wsp+++v+ +l+siqsll++pn++sp+n+eaa+l+++n++ey ++vr
   Q: 95 RWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVR 142
    *********************************************998 PP
   

Organism Schizosaccharomyces pombe
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins. Component of the histone H2B ubiquitin ligase complex (HULC) which plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation (By similarity). Required for obr1 ubiquitination, which regulates mating-type silencing. With cut8, regulates the nuclear accumulation of the proteasome.
Catalyzes the covalent attachment of ubiquitin to other proteins. Component of the histone H2B ubiquitin ligase complex (HULC) which plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation (By similarity). Required for obr1 ubiquitination, which regulates mating-type silencing. With cut8, regulates the nuclear accumulation of the proteasome.
Protein Sequence
(Fasta)
MSTTARRRLM RDFKRMQQDP PAGVSASPVS DNVMLWNAVI IGPADTPFED GTFKLVLSFD 60
EQYPNKPPLV KFVSTMFHPN VYANGELCLD ILQNRWSPTY DVAAILTSIQ SLLNDPNNAS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Spo-108073|E2,E2/UBC|Schizosaccharomyces pombe
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CCCTGCCCTT CTCCAACAAC GCAAATCGGA TATCCTAACT CGGTGTAATT CCAAGGCGAT 60
ATCGATATTT GTGCAACTTT TTTTTAAAGT TATCACAAAT AGAAGAGAGG TTGCTATAAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Spo-108073|E2,E2/UBC|Schizosaccharomyces pombe
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0156--Chromatin regulator
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0227--DNA damage
KW-0234--DNA repair
KW-0547--Nucleotide-binding
KW-0539--Nucleus
KW-1185--Reference proteome
KW-0749--Sporulation
KW-0804--Transcription
KW-0805--Transcription regulation
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:0000790--C:nuclear chromatin
GO:0005634--C:nucleus
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006325--P:chromatin organization
GO:0006281--P:DNA repair
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0030435--P:sporulation resulting in formation of a cellular spore
GO:0006351--P:transcription, DNA-templated

KEGG spo:SPAC18B11.07c
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 69.13 8.00e-63 230.00
IUUC-Aml-002120 Ailuropoda melanoleuca 71.81 2.00e-65 238.00
IUUC-Atr-002623 Amborella trichopoda 71.52 2.00e-64 236.00
IUUC-Apl-004063 Anas platyrhynchos 64.38 6.00e-55 204.00
IUUC-Aca-005001 Anolis carolinensis 71.14 3.00e-65 238.00
IUUC-Aly-005584 Arabidopsis lyrata 70.86 8.00e-64 233.00
IUUC-Ath-007149 Arabidopsis thaliana 70.86 8.00e-64 233.00
IUUC-Ago-007745 Ashbya gossypii 77.33 4.00e-70 254.00
IUUC-Acl-008139 Aspergillus clavatus 82.00 4.00e-75 271.00
IUUC-Afl-008551 Aspergillus flavus 82.67 1.00e-75 272.00
IUUC-Afu-008980 Aspergillus fumigatus 82.67 1.00e-75 272.00
IUUC-Ang-009554 Aspergillus niger 82.67 1.00e-75 272.00
IUUC-Aor-010242 Aspergillus oryzae 82.67 1.00e-75 272.00
IUUC-Ate-010390 Aspergillus terreus 82.67 1.00e-75 272.00
IUUC-Ame-010743 Astyanax mexicanus 72.48 2.00e-66 242.00
IUUC-Bgr-012039 Blumeria graminis 80.00 2.00e-66 242.00
IUUC-Bta-012840 Bos taurus 71.81 2.00e-65 238.00
IUUC-Bci-013919 Botrytis cinerea 82.67 6.00e-76 273.00
IUUC-Bdi-014308 Brachypodium distachyon 70.86 2.00e-63 232.00
IUUC-Bol-016245 Brassica oleracea 70.86 7.00e-64 233.00
IUUC-Bra-016809 Brassica rapa 71.81 7.00e-64 234.00
IUUC-Cel-018244 Caenorhabditis elegans 70.47 2.00e-65 239.00
IUUC-Cja-018783 Callithrix jacchus 72.48 5.00e-66 240.00
IUUC-Cfa-020646 Canis familiaris 72.48 8.00e-66 241.00
IUUC-Cpo-021323 Cavia porcellus 71.81 8.00e-66 240.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 68.99 3.00e-52 195.00
IUUC-Csa-023588 Chlorocebus sabaeus 72.48 5.00e-66 240.00
IUUC-Cho-024773 Choloepus hoffmanni 56.38 1.00e-45 172.00
IUUC-Cin-025537 Ciona intestinalis 69.80 1.00e-53 199.00
IUUC-Csv-025846 Ciona savignyi 71.14 5.00e-58 214.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 82.67 4.00e-75 271.00
IUUC-Cne-026864 Cryptococcus neoformans 73.83 1.00e-66 243.00
IUUC-Cme-027284 Cyanidioschyzon merolae 64.00 4.00e-51 192.00
IUUC-Dre-027775 Danio rerio 73.15 7.00e-67 243.00
IUUC-Dno-029661 Dasypus novemcinctus 71.81 2.00e-65 238.00
IUUC-Dor-030452 Dipodomys ordii 69.40 5.00e-57 210.00
IUUC-Dse-031487 Dothistroma septosporum 81.33 1.00e-74 269.00
IUUC-Dme-031863 Drosophila melanogaster 71.81 2.00e-65 238.00
IUUC-Ete-032595 Echinops telfairi 70.47 3.00e-64 234.00
IUUC-Eca-033377 Equus caballus 71.81 2.00e-65 238.00
IUUC-Eeu-035191 Erinaceus europaeus 56.95 2.00e-45 172.00
IUUC-Fca-036581 Felis catus 72.48 5.00e-66 240.00
IUUC-Fal-037474 Ficedula albicollis 72.41 2.00e-50 188.00
IUUC-Fox-037808 Fusarium oxysporum 82.67 5.00e-75 270.00
IUUC-Fso-038232 Fusarium solani 82.67 5.00e-75 270.00
IUUC-Gmo-038517 Gadus morhua 72.48 5.00e-66 240.00
IUUC-Ggr-039875 Gaeumannomyces graminis 82.12 9.00e-75 270.00
IUUC-Gga-040588 Gallus gallus 72.48 5.00e-66 240.00
IUUC-Gac-042471 Gasterosteus aculeatus 72.48 5.00e-66 240.00
IUUC-Gma-043865 Glycine max 71.52 1.00e-64 236.00
IUUC-Ggo-044896 Gorilla gorilla 72.48 5.00e-66 240.00
IUUC-Hsa-046383 Homo sapiens 72.48 5.00e-66 240.00
IUUC-Hvu-047054 Hordeum vulgare 69.13 8.00e-63 230.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 72.48 5.00e-66 240.00
IUUC-Kpa-049225 Komagataella pastoris 77.18 3.00e-70 254.00
IUUC-Lch-050283 Latimeria chalumnae 72.48 3.00e-66 241.00
IUUC-Lpe-050826 Leersia perrieri 71.52 3.00e-64 234.00
IUUC-Loc-051962 Lepisosteus oculatus 73.15 7.00e-67 243.00
IUUC-Laf-053680 Loxodonta africana 72.48 5.00e-66 240.00
IUUC-Mcc-055546 Macaca mulatta 72.48 1.00e-65 240.00
IUUC-Meu-056231 Macropus eugenii 72.48 5.00e-66 240.00
IUUC-Mor-057087 Magnaporthe oryzae 80.88 2.00e-66 241.00
IUUC-Mpo-057498 Magnaporthe poae 82.12 6.00e-75 271.00
IUUC-Mtr-058305 Medicago truncatula 71.52 3.00e-64 234.00
IUUC-Mla-058876 Melampsora laricipopulina 75.17 2.00e-63 232.00
IUUC-Mga-059863 Meleagris gallopavo 68.61 1.00e-57 213.00
IUUC-Mvi-060330 Microbotryum violaceum 80.54 2.00e-63 232.00
IUUC-Mmr-060630 Microcebus murinus 71.81 2.00e-65 238.00
IUUC-Mdo-062292 Monodelphis domestica 72.48 5.00e-66 240.00
IUUC-Mmu-063680 Mus musculus 72.48 5.00e-66 240.00
IUUC-Mac-064774 Musa acuminata 71.52 6.00e-64 234.00
IUUC-Mpu-065803 Mustela putorius furo 71.81 2.00e-65 238.00
IUUC-Mlu-067147 Myotis lucifugus 71.81 2.00e-65 238.00
IUUC-Nfi-068580 Neosartorya fischeri 82.67 1.00e-75 272.00
IUUC-Ncr-068913 Neurospora crassa 82.67 2.00e-74 269.00
IUUC-Nle-069121 Nomascus leucogenys 72.48 5.00e-66 240.00
IUUC-Opr-070935 Ochotona princeps 71.81 2.00e-65 238.00
IUUC-Ont-071335 Oreochromis niloticus 72.48 3.00e-66 241.00
IUUC-Oan-072706 Ornithorhynchus anatinus 66.67 2.00e-58 215.00
IUUC-Ocu-074550 Oryctolagus cuniculus 72.48 1.00e-65 240.00
IUUC-Oba-075896 Oryza barthii 71.52 3.00e-64 234.00
IUUC-Obr-076713 Oryza brachyantha 71.52 5.00e-64 234.00
IUUC-Ogl-077117 Oryza glaberrima 71.52 3.00e-64 234.00
IUUC-Ogu-078939 Oryza glumaepatula 71.52 3.00e-64 234.00
IUUC-Oin-079769 Oryza indica 71.52 3.00e-64 234.00
IUUC-Olo-081018 Oryza longistaminata 61.31 4.00e-55 205.00
IUUC-Ome-081285 Oryza meridionalis 71.52 5.00e-64 234.00
IUUC-Oni-082537 Oryza nivara 71.52 3.00e-64 234.00
IUUC-Opu-083310 Oryza punctata 71.52 5.00e-64 234.00
IUUC-Oru-084754 Oryza rufipogon 71.52 3.00e-64 234.00
IUUC-Osa-086290 Oryza sativa 71.52 3.00e-64 234.00
IUUC-Ola-087160 Oryzias latipes 72.48 3.00e-66 241.00
IUUC-Olu-087830 Ostreococcus lucimarinus 67.11 3.00e-54 201.00
IUUC-Oga-088659 Otolemur garnettii 72.48 5.00e-66 240.00
IUUC-Oar-090141 Ovis aries 71.81 2.00e-65 238.00
IUUC-Ptr-091305 Pan troglodytes 72.48 5.00e-66 240.00
IUUC-Pan-092740 Papio anubis 72.48 1.00e-65 240.00
IUUC-Psi-094094 Pelodiscus sinensis 72.48 5.00e-66 240.00
IUUC-Pma-094376 Petromyzon marinus 73.83 3.00e-66 241.00
IUUC-Pno-094935 Phaeosphaeria nodorum 81.33 8.00e-75 270.00
IUUC-Ppa-095689 Physcomitrella patens 73.23 6.00e-55 204.00
IUUC-Pfo-096784 Poecilia formosa 72.48 4.00e-66 241.00
IUUC-Pab-097972 Pongo abelii 72.48 5.00e-66 240.00
IUUC-Pop-099517 Populus trichocarpa 71.52 3.00e-64 234.00
IUUC-Pca-100906 Procavia capensis 67.11 5.00e-59 217.00
IUUC-Ppe-101949 Prunus persica 71.52 4.00e-64 235.00
IUUC-Pva-102380 Pteropus vampyrus 71.81 8.00e-64 233.00
IUUC-Pgr-103611 Puccinia graminis 75.84 7.00e-64 233.00
IUUC-Ptt-103971 Puccinia triticina 81.03 1.00e-49 186.00
IUUC-Pte-104378 Pyrenophora teres 81.33 3.00e-74 268.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 81.33 3.00e-74 268.00
IUUC-Rno-105772 Rattus norvegicus 71.81 1.00e-65 239.00
IUUC-Sce-106283 Saccharomyces cerevisiae 77.33 3.00e-70 254.00
IUUC-Sha-107650 Sarcophilus harrisii 71.14 5.00e-64 234.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 98.68 5.00e-78 280.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 82.67 6.00e-76 273.00
IUUC-Smo-109036 Selaginella moellendorffii 69.54 3.00e-63 231.00
IUUC-Sit-110731 Setaria italica 71.52 5.00e-64 234.00
IUUC-Sly-111506 Solanum lycopersicum 71.52 2.00e-64 235.00
IUUC-Stu-112080 Solanum tuberosum 71.52 2.00e-64 235.00
IUUC-Sar-113429 Sorex araneus 71.81 2.00e-65 238.00
IUUC-Sbi-114289 Sorghum bicolor 71.52 5.00e-64 234.00
IUUC-Sre-115106 Sporisorium reilianum 79.19 1.00e-64 236.00
IUUC-Ssc-116265 Sus scrofa 72.48 5.00e-66 240.00
IUUC-Tgu-117383 Taeniopygia guttata 72.48 5.00e-66 240.00
IUUC-Tru-118576 Takifugu rubripes 72.48 5.00e-66 241.00
IUUC-Tsy-119000 Tarsius syrichta 71.81 2.00e-65 238.00
IUUC-Tni-119745 Tetraodon nigroviridis 72.48 5.00e-66 241.00
IUUC-Tca-121827 Theobroma cacao 70.86 4.00e-64 234.00
IUUC-Tre-122002 Trichoderma reesei 82.00 1.00e-74 269.00
IUUC-Tvi-122331 Trichoderma virens 82.00 1.00e-74 269.00
IUUC-Tae-124461 Triticum aestivum 71.14 8.00e-64 234.00
IUUC-Tur-126866 Triticum urartu 69.54 7.00e-63 230.00
IUUC-Tme-127148 Tuber melanosporum 82.78 7.00e-76 273.00
IUUC-Tbe-127921 Tupaia belangeri 69.80 4.00e-61 224.00
IUUC-Ttr-129121 Tursiops truncatus 71.81 2.00e-65 238.00
IUUC-Uma-129561 Ustilago maydis 79.19 8.00e-65 237.00
IUUC-Vda-129711 Verticillium dahliae 82.67 4.00e-75 271.00
IUUC-Vpa-130570 Vicugna pacos 64.18 5.00e-51 191.00
IUUC-Vvi-131108 Vitis vinifera 72.48 1.00e-64 236.00
IUUC-Xtr-131824 Xenopus tropicalis 72.48 4.00e-66 241.00
IUUC-Xma-133667 Xiphophorus maculatus 72.48 3.00e-66 241.00
IUUC-Yli-134660 Yarrowia lipolytica 80.54 3.00e-73 264.00
IUUC-Zma-135584 Zea mays 70.20 1.00e-63 233.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved