• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • Disease
    • ClinVar
    • GWASdb
    • GWAS Central
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Ssl-108432
Ensembl Protein ID EDO00062
UniProt Accession A7EC83; A7EC83_SCLS1
Genbank Protein ID APA09048.1; EDO00062.1
Protein Name Ubiquitin-conjugating enzyme E2
Genbank Nucleotide ID CP017817; CH476623
Gene Name SS1G_02922; sscle_04g038180
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
SS1G_02922 EDO00062 EDO00062
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 5.60e-52 174.2 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++dpp+g+sa+pv + +++ w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ v
   Q: 8 RLMRDFKRMQTDPPAGVSASPVAD-NVMLWNAVIIGPADTPFEDGTFRLVMTFEEQYPNKPPAVKFISQMFHPNVYATGELCLDILQ--NRWSPTYDVAAV 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvre 139
    l+siqsll++pn+ sp+n+ea++l+k+nr+ey k+vre
   Q: 106 LTSIQSLLNDPNTGSPANVEASNLYKDNRREYTKRVRE 143
    ***********************************985 PP
   

Organism Sclerotinia sclerotiorum
Protein Sequence
(Fasta)
MSTAARRRLM RDFKRMQTDP PAGVSASPVA DNVMLWNAVI IGPADTPFED GTFRLVMTFE 60
EQYPNKPPAV KFISQMFHPN VYATGELCLD ILQNRWSPTY DVAAVLTSIQ SLLNDPNTGS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ssl-108432|E2,E2/UBC|Sclerotinia sclerotiorum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCTACAG CTGCTCGTCG TCGTCTTATG CGGGATTTCA AGGTTAGTGG CAATTCGTGG 60
AGGGGCACAA GATCATGATT CGAAGGGAAT CTAACTTTCA TCTATAGCGC ATGCAAACCG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ssl-108432|E2,E2/UBC|Sclerotinia sclerotiorum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006281--P:DNA repair
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0016574--P:histone ubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070534--P:protein K63-linked ubiquitination
GO:0000209--P:protein polyubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG ssl:SS1G_02922
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 65.77 9.00e-62 226.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.08 3.00e-65 238.00
IUUC-Atr-002623 Amborella trichopoda 67.79 7.00e-63 230.00
IUUC-Apl-004063 Anas platyrhynchos 61.74 1.00e-54 202.00
IUUC-Aca-005001 Anolis carolinensis 68.42 5.00e-65 237.00
IUUC-Aly-006336 Arabidopsis lyrata 67.11 1.00e-55 206.00
IUUC-Ath-007547 Arabidopsis thaliana 67.11 1.00e-55 206.00
IUUC-Ago-007745 Ashbya gossypii 76.67 5.00e-71 257.00
IUUC-Acl-008139 Aspergillus clavatus 93.38 9.00e-84 299.00
IUUC-Afl-008551 Aspergillus flavus 94.04 3.00e-84 301.00
IUUC-Afu-008980 Aspergillus fumigatus 94.04 3.00e-84 301.00
IUUC-Ang-009554 Aspergillus niger 94.04 3.00e-84 301.00
IUUC-Aor-010242 Aspergillus oryzae 94.04 3.00e-84 301.00
IUUC-Ate-010390 Aspergillus terreus 94.04 3.00e-84 301.00
IUUC-Ame-010743 Astyanax mexicanus 70.39 5.00e-66 240.00
IUUC-Bgr-012039 Blumeria graminis 96.32 3.00e-77 277.00
IUUC-Bta-012840 Bos taurus 69.08 3.00e-65 238.00
IUUC-Bci-013919 Botrytis cinerea 100.00 3.00e-89 317.00
IUUC-Bdi-015010 Brachypodium distachyon 67.79 1.00e-62 229.00
IUUC-Bol-016245 Brassica oleracea 67.11 1.00e-62 229.00
IUUC-Bra-018026 Brassica rapa 67.11 1.00e-62 229.00
IUUC-Cel-018244 Caenorhabditis elegans 69.80 4.00e-65 238.00
IUUC-Cja-018783 Callithrix jacchus 69.54 2.00e-65 238.00
IUUC-Cfa-020646 Canis familiaris 69.54 4.00e-65 238.00
IUUC-Cpo-021323 Cavia porcellus 70.20 2.00e-65 238.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.44 8.00e-52 193.00
IUUC-Csa-023588 Chlorocebus sabaeus 69.54 2.00e-65 238.00
IUUC-Cho-024773 Choloepus hoffmanni 54.61 2.00e-45 172.00
IUUC-Cin-025537 Ciona intestinalis 69.13 1.00e-54 202.00
IUUC-Csv-025846 Ciona savignyi 69.13 3.00e-58 214.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 97.35 3.00e-86 308.00
IUUC-Cne-026864 Cryptococcus neoformans 71.14 4.00e-66 241.00
IUUC-Cme-027284 Cyanidioschyzon merolae 64.67 1.00e-51 194.00
IUUC-Dre-027775 Danio rerio 69.74 5.00e-66 240.00
IUUC-Dno-029661 Dasypus novemcinctus 69.08 3.00e-65 238.00
IUUC-Dor-030452 Dipodomys ordii 66.42 8.00e-57 209.00
IUUC-Dse-031487 Dothistroma septosporum 94.04 9.00e-85 302.00
IUUC-Dme-031863 Drosophila melanogaster 70.86 2.00e-65 238.00
IUUC-Ete-032595 Echinops telfairi 66.45 4.00e-63 231.00
IUUC-Eca-033377 Equus caballus 69.08 3.00e-65 238.00
IUUC-Eeu-035191 Erinaceus europaeus 55.56 3.00e-45 171.00
IUUC-Fca-036581 Felis catus 69.54 2.00e-65 238.00
IUUC-Fal-037474 Ficedula albicollis 68.64 4.00e-50 187.00
IUUC-Fox-037808 Fusarium oxysporum 96.69 9.00e-86 306.00
IUUC-Fso-038232 Fusarium solani 96.03 3.00e-85 304.00
IUUC-Gmo-038517 Gadus morhua 69.54 2.00e-65 238.00
IUUC-Ggr-039875 Gaeumannomyces graminis 94.74 2.00e-84 301.00
IUUC-Gga-040588 Gallus gallus 69.54 2.00e-65 238.00
IUUC-Gac-042471 Gasterosteus aculeatus 69.08 2.00e-65 238.00
IUUC-Gma-043688 Glycine max 68.46 3.00e-63 231.00
IUUC-Ggo-044896 Gorilla gorilla 69.54 2.00e-65 238.00
IUUC-Hsa-046383 Homo sapiens 69.54 2.00e-65 238.00
IUUC-Hvu-047054 Hordeum vulgare 65.77 9.00e-62 226.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 69.54 2.00e-65 238.00
IUUC-Kpa-049225 Komagataella pastoris 80.54 3.00e-73 265.00
IUUC-Lch-050283 Latimeria chalumnae 69.54 1.00e-65 239.00
IUUC-Lpe-051301 Leersia perrieri 67.79 8.00e-63 229.00
IUUC-Loc-051962 Lepisosteus oculatus 71.05 1.00e-66 242.00
IUUC-Laf-053680 Loxodonta africana 69.54 2.00e-65 238.00
IUUC-Mcc-054819 Macaca mulatta 69.08 3.00e-65 238.00
IUUC-Meu-056231 Macropus eugenii 69.54 2.00e-65 238.00
IUUC-Mor-057087 Magnaporthe oryzae 94.07 6.00e-75 270.00
IUUC-Mpo-057498 Magnaporthe poae 94.74 1.00e-84 303.00
IUUC-Mtr-058612 Medicago truncatula 67.79 1.00e-54 202.00
IUUC-Mla-058876 Melampsora laricipopulina 74.83 2.00e-64 235.00
IUUC-Mga-059863 Meleagris gallopavo 65.71 2.00e-57 211.00
IUUC-Mvi-060330 Microbotryum violaceum 74.34 8.00e-63 229.00
IUUC-Mmr-060630 Microcebus murinus 69.08 3.00e-65 238.00
IUUC-Mdo-062292 Monodelphis domestica 69.54 2.00e-65 238.00
IUUC-Mmu-063680 Mus musculus 69.54 2.00e-65 238.00
IUUC-Mac-064774 Musa acuminata 67.79 1.00e-62 229.00
IUUC-Mpu-065803 Mustela putorius furo 69.08 3.00e-65 238.00
IUUC-Mlu-067147 Myotis lucifugus 69.08 3.00e-65 238.00
IUUC-Nfi-068580 Neosartorya fischeri 94.04 3.00e-84 301.00
IUUC-Ncr-068913 Neurospora crassa 95.36 9.00e-85 302.00
IUUC-Nle-069121 Nomascus leucogenys 69.54 2.00e-65 238.00
IUUC-Opr-070935 Ochotona princeps 69.08 3.00e-65 238.00
IUUC-Ont-071335 Oreochromis niloticus 69.08 9.00e-66 239.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.95 3.00e-58 214.00
IUUC-Ocu-074550 Oryctolagus cuniculus 69.54 5.00e-65 238.00
IUUC-Oba-075896 Oryza barthii 67.79 8.00e-63 229.00
IUUC-Obr-076770 Oryza brachyantha 68.46 3.00e-63 231.00
IUUC-Ogl-077116 Oryza glaberrima 67.79 8.00e-63 229.00
IUUC-Ogu-078696 Oryza glumaepatula 67.79 8.00e-63 229.00
IUUC-Oin-079099 Oryza indica 67.79 8.00e-63 229.00
IUUC-Olo-081018 Oryza longistaminata 56.97 7.00e-53 197.00
IUUC-Ome-081285 Oryza meridionalis 67.79 8.00e-63 229.00
IUUC-Oni-082088 Oryza nivara 67.79 8.00e-63 229.00
IUUC-Opu-083310 Oryza punctata 67.79 8.00e-63 229.00
IUUC-Oru-084449 Oryza rufipogon 67.79 8.00e-63 229.00
IUUC-Osa-085923 Oryza sativa 67.79 8.00e-63 229.00
IUUC-Ola-087160 Oryzias latipes 69.08 9.00e-66 239.00
IUUC-Olu-087830 Ostreococcus lucimarinus 66.44 2.00e-54 202.00
IUUC-Oga-088659 Otolemur garnettii 69.54 2.00e-65 238.00
IUUC-Oar-090141 Ovis aries 69.08 3.00e-65 238.00
IUUC-Ptr-091305 Pan troglodytes 69.54 2.00e-65 238.00
IUUC-Pan-092511 Papio anubis 69.08 3.00e-65 238.00
IUUC-Psi-094094 Pelodiscus sinensis 69.54 2.00e-65 238.00
IUUC-Pma-094376 Petromyzon marinus 69.74 1.00e-65 239.00
IUUC-Pno-094935 Phaeosphaeria nodorum 92.72 5.00e-83 296.00
IUUC-Ppa-095689 Physcomitrella patens 69.29 1.00e-53 199.00
IUUC-Pfo-096784 Poecilia formosa 69.08 2.00e-65 238.00
IUUC-Pab-097972 Pongo abelii 69.54 2.00e-65 238.00
IUUC-Pop-099517 Populus trichocarpa 67.79 6.00e-63 230.00
IUUC-Pca-100906 Procavia capensis 64.24 2.00e-58 215.00
IUUC-Ppe-101594 Prunus persica 67.79 6.00e-63 230.00
IUUC-Pva-102380 Pteropus vampyrus 68.87 4.00e-63 231.00
IUUC-Pgr-103611 Puccinia graminis 74.83 9.00e-65 236.00
IUUC-Ptt-103971 Puccinia triticina 77.97 7.00e-50 186.00
IUUC-Pte-104378 Pyrenophora teres 92.72 1.00e-83 299.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 92.72 1.00e-83 299.00
IUUC-Rno-105772 Rattus norvegicus 69.08 2.00e-65 238.00
IUUC-Sce-106283 Saccharomyces cerevisiae 76.67 5.00e-71 257.00
IUUC-Sha-107650 Sarcophilus harrisii 68.42 7.00e-64 233.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 82.67 4.00e-68 247.00
IUUC-Spo-108073 Schizosaccharomyces pombe 82.67 4.00e-68 247.00
IUUC-Smo-109512 Selaginella moellendorffii 67.76 4.00e-63 231.00
IUUC-Sit-110731 Setaria italica 67.79 8.00e-63 229.00
IUUC-Sly-111506 Solanum lycopersicum 67.79 5.00e-63 230.00
IUUC-Stu-112518 Solanum tuberosum 67.11 6.00e-63 231.00
IUUC-Sar-113429 Sorex araneus 69.08 3.00e-65 238.00
IUUC-Sbi-114289 Sorghum bicolor 67.79 8.00e-63 229.00
IUUC-Sre-115106 Sporisorium reilianum 73.03 1.00e-63 233.00
IUUC-Ssc-116265 Sus scrofa 69.54 2.00e-65 238.00
IUUC-Tgu-117383 Taeniopygia guttata 69.54 2.00e-65 238.00
IUUC-Tru-118576 Takifugu rubripes 69.08 3.00e-65 238.00
IUUC-Tsy-119000 Tarsius syrichta 69.08 3.00e-65 238.00
IUUC-Tni-119745 Tetraodon nigroviridis 69.08 2.00e-65 238.00
IUUC-Tca-121827 Theobroma cacao 68.46 4.00e-63 231.00
IUUC-Tre-122002 Trichoderma reesei 95.36 3.00e-85 304.00
IUUC-Tvi-122331 Trichoderma virens 95.36 3.00e-85 304.00
IUUC-Tae-124461 Triticum aestivum 67.11 2.00e-62 229.00
IUUC-Tur-126866 Triticum urartu 66.44 3.00e-62 228.00
IUUC-Tme-127148 Tuber melanosporum 92.67 2.00e-83 298.00
IUUC-Tbe-127921 Tupaia belangeri 67.11 1.00e-60 223.00
IUUC-Ttr-129121 Tursiops truncatus 69.08 3.00e-65 238.00
IUUC-Uma-129561 Ustilago maydis 73.03 8.00e-64 233.00
IUUC-Vda-129711 Verticillium dahliae 97.35 3.00e-86 308.00
IUUC-Vpa-130570 Vicugna pacos 61.31 6.00e-51 190.00
IUUC-Vvi-131108 Vitis vinifera 67.79 3.00e-63 231.00
IUUC-Xtr-131824 Xenopus tropicalis 69.08 1.00e-65 239.00
IUUC-Xma-133667 Xiphophorus maculatus 69.08 9.00e-66 239.00
IUUC-Yli-134660 Yarrowia lipolytica 84.11 3.00e-77 277.00
IUUC-Zma-135584 Zea mays 66.44 4.00e-62 228.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved