• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bta-012740
UUCD1 version UUC-BoT-01028
Ensembl Protein ID ENSBTAP00000012136.3
UniProt Accession Q1RML1; A6QLZ2; UBE2S_BOVIN
Genbank Protein ID AAI14839.1; AAI48139.1
Protein Name Ubiquitin-conjugating enzyme E2 S; E2 ubiquitin-conjugating enzyme S; Ubiquitin carrier protein S; Ubiquitin-protein ligase S
Genbank Nucleotide ID BC114838; BC148138
Gene Name UBE2S
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000009211.3 ENSBTAT00000012136.3 ENSBTAP00000012136.3
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 2.00e-40 137.9 17 149
Active Site
Position(s) Description Evidence
95 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 3    kkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeek 91
    +ke+++l++dpp+gi++ p++e dlt+++v+i+Gpe+tpY+gg+F++++ + +d+P++PPk fltkifhPnv +nG++C+++lk ++
   Q: 17 YKEVTTLTADPPDGIKVFPNEE-DLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLK--RD 102
    79********************.9************************************************************9..** PP
   S: 92 Wspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    W++ l +++vll+i+ ll +pnpes+lneea +ll +n eey ++r
   Q: 103 WTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARAR 149
    ******************************************99876 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination.
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination.
Protein Sequence
(Fasta)
MNSNVENLPP HIIRLVYKEV TTLTADPPDG IKVFPNEEDL TDLQVTIEGP EGTPYAGGLF 60
RMKLLLGKDF PASPPKGYFL TKIFHPNVGA NGEICVNVLK RDWTAELGIR HVLLTIKCLL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-012740|E2,E2/UBC|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GTAGGCGGAT ATAAAAGGGT GCCCGTGCGC GCGCGGCCGG CTTACTGCGG CCGGTCACTG 60
GGACGGGTGG AGCTGCTGTA CGGTTTGCGG CGGACGTCGG AGGCTGCGAG AAGCAGAGCG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-012740|E2,E2/UBC|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0007--Acetylation
KW-0067--ATP-binding
KW-0131--Cell cycle
KW-0132--Cell division
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0808--Transferase
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005680--C:anaphase-promoting complex
GO:0005737--C:cytoplasm
GO:0005634--C:nucleus
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0004842--F:ubiquitin-protein transferase activity
GO:0031145--P:anaphase-promoting complex-dependent catabolic process
GO:0051301--P:cell division
GO:0010458--P:exit from mitosis
GO:0010994--P:free ubiquitin chain polymerization
GO:1904668--P:positive regulation of ubiquitin protein ligase activity
GO:0070979--P:protein K11-linked ubiquitination
GO:0044314--P:protein K27-linked ubiquitination
GO:0035519--P:protein K29-linked ubiquitination
GO:0085020--P:protein K6-linked ubiquitination
GO:0070534--P:protein K63-linked ubiquitination
GO:0000209--P:protein polyubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG bta:617703
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000818 Aegilops tauschii 64.00 3.00e-48 184.00
IUUC-Aml-001979 Ailuropoda melanoleuca 99.35 4.00e-88 317.00
IUUC-Atr-002706 Amborella trichopoda 64.67 2.00e-47 182.00
IUUC-Aca-004432 Anolis carolinensis 78.71 6.00e-89 319.00
IUUC-Aly-005779 Arabidopsis lyrata 64.52 1.00e-57 216.00
IUUC-Ath-007162 Arabidopsis thaliana 65.16 5.00e-58 217.00
IUUC-Acl-008107 Aspergillus clavatus 50.81 5.00e-34 138.00
IUUC-Afl-008578 Aspergillus flavus 57.41 4.00e-34 139.00
IUUC-Afu-009034 Aspergillus fumigatus 51.18 1.00e-34 140.00
IUUC-Ani-009151 Aspergillus nidulans 52.34 1.00e-35 144.00
IUUC-Ang-009649 Aspergillus niger 51.16 1.00e-35 144.00
IUUC-Ame-010836 Astyanax mexicanus 59.62 7.00e-79 286.00
IUUC-Bdi-014057 Brachypodium distachyon 64.67 3.00e-48 184.00
IUUC-Bol-016481 Brassica oleracea 65.81 6.00e-58 216.00
IUUC-Bra-016867 Brassica rapa 65.16 6.00e-58 217.00
IUUC-Cja-019763 Callithrix jacchus 92.12 7.00e-91 326.00
IUUC-Cfa-020216 Canis familiaris 92.61 2.00e-89 321.00
IUUC-Cpo-021720 Cavia porcellus 100.00 4.00e-88 317.00
IUUC-Cre-022676 Chlamydomonas reinhardtii 60.67 4.00e-55 206.00
IUUC-Csa-023751 Chlorocebus sabaeus 92.61 3.00e-91 327.00
IUUC-Cho-024620 Choloepus hoffmanni 98.23 2.00e-63 233.00
IUUC-Cin-025632 Ciona intestinalis 56.52 5.00e-65 240.00
IUUC-Csv-025984 Ciona savignyi 67.10 3.00e-63 234.00
IUUC-Cne-026844 Cryptococcus neoformans 54.05 9.00e-48 183.00
IUUC-Cme-027294 Cyanidioschyzon merolae 58.06 5.00e-51 194.00
IUUC-Dre-027674 Danio rerio 61.20 8.00e-81 292.00
IUUC-Dno-029886 Dasypus novemcinctus 95.07 2.00e-89 321.00
IUUC-Dor-030440 Dipodomys ordii 92.12 2.00e-96 344.00
IUUC-Dse-031211 Dothistroma septosporum 47.06 7.00e-31 125.00
IUUC-Dme-031888 Drosophila melanogaster 67.97 2.00e-62 231.00
IUUC-Ete-032365 Echinops telfairi 84.48 8.00e-66 242.00
IUUC-Eca-033733 Equus caballus 98.71 3.00e-87 314.00
IUUC-Eeu-035342 Erinaceus europaeus 96.75 3.00e-85 307.00
IUUC-Fca-035964 Felis catus 100.00 1.00e-62 232.00
IUUC-Gmo-039357 Gadus morhua 64.95 1.00e-75 275.00
IUUC-Gga-040261 Gallus gallus 87.23 2.00e-46 178.00
IUUC-Gac-042593 Gasterosteus aculeatus 81.29 7.00e-76 276.00
IUUC-Gma-043597 Glycine max 64.00 3.00e-57 214.00
IUUC-Ggo-044626 Gorilla gorilla 90.91 2.00e-62 231.00
IUUC-Hsa-046058 Homo sapiens 92.61 1.00e-91 328.00
IUUC-Hvu-047281 Hordeum vulgare 64.67 2.00e-48 186.00
IUUC-Itr-048739 Ictidomys tridecemlineatus 90.15 2.00e-93 334.00
IUUC-Lch-049415 Latimeria chalumnae 70.62 1.00e-58 218.00
IUUC-Lpe-050956 Leersia perrieri 52.00 2.00e-32 132.00
IUUC-Lma-052996 Leptosphaeria maculans 52.78 7.00e-32 131.00
IUUC-Laf-053337 Loxodonta africana 93.56 1.00e-87 315.00
IUUC-Mcc-055485 Macaca mulatta 82.89 7.00e-88 316.00
IUUC-Meu-056123 Macropus eugenii 97.40 5.00e-86 310.00
IUUC-Mtr-058300 Medicago truncatula 64.00 3.00e-55 207.00
IUUC-Mla-059060 Melampsora laricipopulina 53.33 2.00e-48 184.00
IUUC-Mmr-061005 Microcebus murinus 100.00 9.00e-89 319.00
IUUC-Mdo-062979 Monodelphis domestica 97.60 8.00e-69 252.00
IUUC-Mmu-063778 Mus musculus 91.04 5.00e-95 340.00
IUUC-Mac-065490 Musa acuminata 65.33 4.00e-48 185.00
IUUC-Mpu-065829 Mustela putorius furo 94.09 1.00e-89 322.00
IUUC-Mlu-067498 Myotis lucifugus 95.45 2.00e-80 291.00
IUUC-Nfi-068520 Neosartorya fischeri 51.18 1.00e-34 140.00
IUUC-Nle-069727 Nomascus leucogenys 92.61 4.00e-91 327.00
IUUC-Opr-071066 Ochotona princeps 98.25 1.00e-63 233.00
IUUC-Ont-072363 Oreochromis niloticus 65.26 1.00e-74 271.00
IUUC-Oan-073383 Ornithorhynchus anatinus 77.27 2.00e-56 210.00
IUUC-Ocu-074599 Oryctolagus cuniculus 98.50 3.00e-75 273.00
IUUC-Oba-075186 Oryza barthii 65.33 4.00e-50 191.00
IUUC-Obr-076104 Oryza brachyantha 65.33 1.00e-48 186.00
IUUC-Ogl-077835 Oryza glaberrima 65.33 3.00e-50 191.00
IUUC-Ogu-078690 Oryza glumaepatula 65.33 3.00e-50 191.00
IUUC-Oin-080215 Oryza indica 65.33 4.00e-50 191.00
IUUC-Olo-080816 Oryza longistaminata 65.33 4.00e-50 191.00
IUUC-Ome-081657 Oryza meridionalis 65.33 8.00e-50 190.00
IUUC-Oni-082601 Oryza nivara 65.33 3.00e-50 191.00
IUUC-Opu-083367 Oryza punctata 66.00 6.00e-50 190.00
IUUC-Oru-084477 Oryza rufipogon 65.33 3.00e-50 191.00
IUUC-Osa-086119 Oryza sativa 65.33 3.00e-50 191.00
IUUC-Ola-086702 Oryzias latipes 66.04 5.00e-77 280.00
IUUC-Olu-087576 Ostreococcus lucimarinus 54.97 9.00e-47 179.00
IUUC-Oga-088946 Otolemur garnettii 92.12 9.00e-89 319.00
IUUC-Oar-089564 Ovis aries 98.80 3.00e-88 317.00
IUUC-Ptr-090620 Pan troglodytes 93.07 5.00e-91 326.00
IUUC-Pan-092382 Papio anubis 82.89 8.00e-88 316.00
IUUC-Psi-093891 Pelodiscus sinensis 89.47 3.00e-60 223.00
IUUC-Pma-094344 Petromyzon marinus 82.35 1.00e-74 272.00
IUUC-Ppa-095452 Physcomitrella patens 60.39 2.00e-46 178.00
IUUC-Pfo-097288 Poecilia formosa 66.51 1.00e-77 282.00
IUUC-Pab-098506 Pongo abelii 92.61 4.00e-91 327.00
IUUC-Pop-098882 Populus trichocarpa 63.33 8.00e-57 213.00
IUUC-Pca-100749 Procavia capensis 92.61 6.00e-96 342.00
IUUC-Ppe-102084 Prunus persica 64.00 1.00e-56 213.00
IUUC-Pva-102755 Pteropus vampyrus 94.09 3.00e-97 347.00
IUUC-Pgr-103394 Puccinia graminis 54.30 9.00e-48 183.00
IUUC-Ptt-103750 Puccinia triticina 54.30 8.00e-48 183.00
IUUC-Pte-104240 Pyrenophora teres 50.00 3.00e-31 129.00
IUUC-Pyt-104483 Pyrenophora triticirepentis 49.22 8.00e-31 127.00
IUUC-Rno-105739 Rattus norvegicus 91.13 5.00e-98 350.00
IUUC-Smo-108939 Selaginella moellendorffii 60.00 2.00e-45 175.00
IUUC-Sit-109881 Setaria italica 65.33 6.00e-49 187.00
IUUC-Sly-111764 Solanum lycopersicum 62.67 8.00e-57 213.00
IUUC-Stu-111968 Solanum tuberosum 62.67 9.00e-57 213.00
IUUC-Sar-113093 Sorex araneus 62.56 2.00e-58 218.00
IUUC-Sbi-113842 Sorghum bicolor 66.00 8.00e-49 186.00
IUUC-Sre-115036 Sporisorium reilianum 44.30 6.00e-33 133.00
IUUC-Tru-117716 Takifugu rubripes 66.98 8.00e-78 282.00
IUUC-Tni-120210 Tetraodon nigroviridis 66.51 1.00e-77 281.00
IUUC-Tca-121315 Theobroma cacao 64.00 4.00e-57 214.00
IUUC-Tae-122761 Triticum aestivum 64.00 3.00e-48 184.00
IUUC-Tur-126669 Triticum urartu 64.00 4.00e-48 185.00
IUUC-Tme-127125 Tuber melanosporum 48.73 9.00e-39 153.00
IUUC-Tbe-128157 Tupaia belangeri 99.35 1.00e-87 315.00
IUUC-Ttr-128593 Tursiops truncatus 94.09 9.00e-98 348.00
IUUC-Uma-129592 Ustilago maydis 49.66 4.00e-40 157.00
IUUC-Vvi-131716 Vitis vinifera 63.33 4.00e-57 214.00
IUUC-Xtr-132592 Xenopus tropicalis 74.40 7.00e-85 306.00
IUUC-Xma-133064 Xiphophorus maculatus 64.19 3.00e-69 254.00
IUUC-Yli-134575 Yarrowia lipolytica 49.65 2.00e-37 148.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved