• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Sce-106387
UUCD1 version UUC-SaC-00036
Ensembl Protein ID YDR328C
UniProt Accession P52286; D6VSW0; Q07186; SKP1_YEAST
Genbank Protein ID AAB17500.1; AAC49492.1; AAB64763.1; AAS56056.1; DAA12170.1
Protein Name Suppressor of kinetochore protein 1; Centromere DNA-binding protein complex CBF3 subunit D; E3 ubiquitin ligase complex SCF subunit SKP1
Genbank Nucleotide ID U43179; U61764; U32517; AY557730; BK006938
Gene Name SKP1; CBF3D; YDR328C; D9798.14
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
YDR328C YDR328C YDR328C
Annotation
mRNA Expression
GEOFFGED
Protein-protein Interaction
IIDiRefIndexHINTMentha
Protein 3D Structure
PDBMMDB
Post-translational Modifications (PTMs)
CPLMdbPAFdbPTMUniProt
PHOSIDABioGRID
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/SCF/SKP1 SKP1 11287615
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 1.40e-28 97.3 144 191
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd++ck+Va+mi+g++peeiR+tFni nDftpeEea++R+En+WA
   Q: 144 KPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWA 191
    79*********************************************9 PP
   

Organism Saccharomyces cerevisiae
Functional Description
(View)

Functional Description



     Essential component of the E3 ubiquitin ligase complex SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins like phosphorylated SIC1. Participates in the attachment of chromosomes to the spindle. Acts as a regulatory component of the centromere DNA-binding protein complex CBF3, which is essential for chromosome segregation and movement of centromeres along microtubules. CBF3 is required for the recruitment of other kinetochore complexes to CEN DNA. It plays a role in the attachment of chromosomes to the spindle and binds selectively to a highly conserved DNA sequence called CDEIII, found in centromeres and in several promoters. The association of CBF3C with CBF3D and SGT1 is required for CBF3C activation and CBF3 assembly. SKP1/CBF3D could retrieve cyclins or cyclin-CDK-like proteins into the kinetochore thus providing cell cycle-regulated kinetochore activity. Involved in the regulation of methionine biosynthesis genes. Facilitates association of CDC53 with CDC4 and of ROY1 with YPT52.
Essential component of the E3 ubiquitin ligase complex SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins like phosphorylated SIC1. Participates in the attachment of chromosomes to the spindle. Acts as a regulatory component of the centromere DNA-binding protein complex CBF3, which is essential for chromosome segregation and movement of centromeres along microtubules. CBF3 is required for the recruitment of other kinetochore complexes to CEN DNA. It plays a role in the attachment of chromosomes to the spindle and binds selectively to a highly conserved DNA sequence called CDEIII, found in centromeres and in several promoters. The association of CBF3C with CBF3D and SGT1 is required for CBF3C activation and CBF3 assembly. SKP1/CBF3D could retrieve cyclins or cyclin-CDK-like proteins into the kinetochore thus providing cell cycle-regulated kinetochore activity. Involved in the regulation of methionine biosynthesis genes. Facilitates association of CDC53 with CDC4 and of ROY1 with YPT52.
Protein Sequence
(Fasta)
MVTSNVVLVS GEGERFTVDK KIAERSLLLK NYLNDMHDSN LQNNSDSESD SDSETNHKSK 60
DNNNGDDDDE DDDEIVMPVP NVRSSVLQKV IEWAEHHRDS NFPDEDDDDS RKSAPVDSWD 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sce-106387|E3,SKP1|Saccharomyces cerevisiae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGTGACTT CTAATGTTGT CCTAGTGAGT GGTGAGGGTG AACGATTCAC CGTAGACAAG 60
AAAATCGCGG AGAGATCCCT GCTATTGAAA AACTATCTGA ACGATATGCA TGACAGCAAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sce-106387|E3,SKP1|Saccharomyces cerevisiae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0137--Centromere
KW-0158--Chromosome
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0903--Direct protein sequencing
KW-0238--DNA-binding
KW-0995--Kinetochore
KW-0539--Nucleus
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0031518--C:CBF3 complex
GO:0000777--C:condensed chromosome kinetochore
GO:0005737--C:cytoplasm
GO:0000776--C:kinetochore
GO:0005634--C:nucleus
GO:0043291--C:RAVE complex
GO:0019005--C:SCF ubiquitin ligase complex
GO:0003688--F:DNA replication origin binding
GO:0010458--P:exit from mitosis
GO:0000082--P:G1/S transition of mitotic cell cycle
GO:0000086--P:G2/M transition of mitotic cell cycle
GO:0051382--P:kinetochore assembly
GO:2000766--P:negative regulation of cytoplasmic translation
GO:0006461--P:protein complex assembly
GO:0045116--P:protein neddylation
GO:0042787--P:protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0007096--P:regulation of exit from mitosis
GO:0043254--P:regulation of protein complex assembly
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0000921--P:septin ring assembly
GO:0007035--P:vacuolar acidification

KEGG sce:YDR328C
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 57.63 3.00e-36 142.00
IUUC-Aml-002023 Ailuropoda melanoleuca 57.14 3.00e-35 138.00
IUUC-Atr-002858 Amborella trichopoda 56.52 3.00e-32 128.00
IUUC-Apl-003393 Anas platyrhynchos 57.14 3.00e-35 138.00
IUUC-Aca-004709 Anolis carolinensis 57.14 3.00e-35 138.00
IUUC-Aly-006236 Arabidopsis lyrata 37.63 5.00e-33 131.00
IUUC-Ath-007456 Arabidopsis thaliana 52.59 7.00e-33 130.00
IUUC-Ago-007847 Ashbya gossypii 79.89 8.00e-80 286.00
IUUC-Acl-008178 Aspergillus clavatus 49.74 2.00e-49 186.00
IUUC-Afl-008452 Aspergillus flavus 48.72 2.00e-48 182.00
IUUC-Afu-008785 Aspergillus fumigatus 50.26 2.00e-49 185.00
IUUC-Ani-009312 Aspergillus nidulans 49.74 6.00e-46 174.00
IUUC-Aor-010012 Aspergillus oryzae 48.72 2.00e-48 182.00
IUUC-Ate-010375 Aspergillus terreus 50.26 5.00e-49 184.00
IUUC-Ame-011025 Astyanax mexicanus 57.14 3.00e-35 139.00
IUUC-Bgr-012280 Blumeria graminis 43.58 9.00e-37 143.00
IUUC-Bta-013519 Bos taurus 57.14 3.00e-35 138.00
IUUC-Bci-013888 Botrytis cinerea 61.54 5.00e-33 131.00
IUUC-Bdi-014547 Brachypodium distachyon 53.04 9.00e-31 124.00
IUUC-Bol-016431 Brassica oleracea 40.41 5.00e-30 121.00
IUUC-Bra-017062 Brassica rapa 55.24 1.00e-19 86.70
IUUC-Cel-018653 Caenorhabditis elegans 61.02 4.00e-39 151.00
IUUC-Cja-019823 Callithrix jacchus 53.78 2.00e-31 125.00
IUUC-Cfa-020931 Canis familiaris 57.14 4.00e-35 138.00
IUUC-Cpo-022487 Cavia porcellus 57.26 2.00e-34 135.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 39.58 5.00e-33 131.00
IUUC-Csa-023459 Chlorocebus sabaeus 56.30 1.00e-34 137.00
IUUC-Cho-024854 Choloepus hoffmanni 44.26 7.00e-09 50.80
IUUC-Cin-025538 Ciona intestinalis 52.54 2.00e-33 132.00
IUUC-Csv-025865 Ciona savignyi 55.08 8.00e-38 147.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 46.24 1.00e-39 153.00
IUUC-Cne-027058 Cryptococcus neoformans 46.39 1.00e-47 179.00
IUUC-Cme-027174 Cyanidioschyzon merolae 36.90 2.00e-29 119.00
IUUC-Dre-027756 Danio rerio 57.14 3.00e-35 139.00
IUUC-Dno-028924 Dasypus novemcinctus 57.14 3.00e-35 138.00
IUUC-Dor-030847 Dipodomys ordii 53.39 2.00e-33 132.00
IUUC-Dse-031209 Dothistroma septosporum 46.39 9.00e-43 163.00
IUUC-Dme-032028 Drosophila melanogaster 55.00 8.00e-38 147.00
IUUC-Ete-033117 Echinops telfairi 55.08 2.00e-34 136.00
IUUC-Eca-033320 Equus caballus 57.14 3.00e-35 138.00
IUUC-Eeu-034817 Erinaceus europaeus 53.19 1.00e-10 55.50
IUUC-Fca-035423 Felis catus 57.14 3.00e-35 138.00
IUUC-Fal-036956 Ficedula albicollis 57.14 3.00e-35 138.00
IUUC-Fox-037761 Fusarium oxysporum 46.07 4.00e-41 158.00
IUUC-Fso-038451 Fusarium solani 45.81 2.00e-41 159.00
IUUC-Gmo-039178 Gadus morhua 57.14 3.00e-35 139.00
IUUC-Ggr-039831 Gaeumannomyces graminis 44.00 1.00e-39 153.00
IUUC-Gga-040238 Gallus gallus 57.14 3.00e-35 138.00
IUUC-Gac-041965 Gasterosteus aculeatus 57.14 3.00e-35 139.00
IUUC-Gma-043062 Glycine max 55.65 4.00e-32 128.00
IUUC-Ggo-045025 Gorilla gorilla 57.14 3.00e-35 138.00
IUUC-Hsa-046875 Homo sapiens 57.14 3.00e-35 138.00
IUUC-Hvu-047497 Hordeum vulgare 52.94 3.00e-32 128.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 56.30 9.00e-35 137.00
IUUC-Kpa-049138 Komagataella pastoris 57.89 2.00e-59 219.00
IUUC-Lch-050522 Latimeria chalumnae 43.32 1.00e-36 143.00
IUUC-Lpe-050697 Leersia perrieri 50.43 2.00e-31 126.00
IUUC-Loc-052596 Lepisosteus oculatus 57.14 3.00e-35 139.00
IUUC-Lma-053020 Leptosphaeria maculans 42.29 2.00e-33 132.00
IUUC-Laf-053847 Loxodonta africana 57.14 3.00e-35 138.00
IUUC-Mor-057176 Magnaporthe oryzae 44.00 1.00e-39 153.00
IUUC-Mpo-057471 Magnaporthe poae 44.00 1.00e-39 153.00
IUUC-Mtr-058461 Medicago truncatula 53.85 3.00e-33 132.00
IUUC-Mla-059153 Melampsora laricipopulina 48.17 6.00e-45 171.00
IUUC-Mga-059864 Meleagris gallopavo 57.14 3.00e-35 138.00
IUUC-Mvi-060342 Microbotryum violaceum 48.98 2.00e-49 186.00
IUUC-Mdo-062509 Monodelphis domestica 57.14 3.00e-35 138.00
IUUC-Mmu-063694 Mus musculus 57.14 3.00e-35 139.00
IUUC-Mac-065207 Musa acuminata 57.26 4.00e-32 128.00
IUUC-Mpu-065990 Mustela putorius furo 57.14 3.00e-35 138.00
IUUC-Mlu-068168 Myotis lucifugus 57.14 3.00e-35 138.00
IUUC-Nfi-068309 Neosartorya fischeri 50.26 2.00e-49 185.00
IUUC-Ncr-068658 Neurospora crassa 49.71 2.00e-43 166.00
IUUC-Nle-070101 Nomascus leucogenys 57.14 3.00e-35 138.00
IUUC-Opr-070881 Ochotona princeps 57.14 3.00e-35 138.00
IUUC-Ont-071529 Oreochromis niloticus 57.14 3.00e-35 139.00
IUUC-Oan-073000 Ornithorhynchus anatinus 67.24 2.00e-21 90.90
IUUC-Ocu-073780 Oryctolagus cuniculus 57.14 3.00e-35 138.00
IUUC-Oba-075110 Oryza barthii 36.02 2.00e-28 116.00
IUUC-Obr-076218 Oryza brachyantha 54.17 2.00e-30 123.00
IUUC-Ogl-077679 Oryza glaberrima 49.61 4.00e-27 112.00
IUUC-Ogu-077993 Oryza glumaepatula 34.90 3.00e-28 115.00
IUUC-Oin-079779 Oryza indica 49.61 4.00e-27 111.00
IUUC-Olo-080736 Oryza longistaminata 34.90 4.00e-28 115.00
IUUC-Ome-081330 Oryza meridionalis 48.41 4.00e-27 111.00
IUUC-Oni-082143 Oryza nivara 49.61 4.00e-27 111.00
IUUC-Opu-083972 Oryza punctata 34.39 5.00e-28 115.00
IUUC-Oru-084769 Oryza rufipogon 36.02 9.00e-29 117.00
IUUC-Osa-085479 Oryza sativa 36.02 9.00e-29 117.00
IUUC-Ola-087270 Oryzias latipes 57.14 3.00e-35 139.00
IUUC-Olu-087667 Ostreococcus lucimarinus 52.99 3.00e-33 132.00
IUUC-Oga-089073 Otolemur garnettii 57.14 3.00e-35 138.00
IUUC-Oar-089762 Ovis aries 44.26 2.00e-30 123.00
IUUC-Ptr-090872 Pan troglodytes 56.30 5.00e-34 134.00
IUUC-Pan-091780 Papio anubis 57.14 3.00e-35 138.00
IUUC-Psi-093135 Pelodiscus sinensis 57.14 3.00e-35 138.00
IUUC-Pno-094810 Phaeosphaeria nodorum 41.71 9.00e-33 130.00
IUUC-Ppa-095244 Physcomitrella patens 56.03 7.00e-33 130.00
IUUC-Pfo-097529 Poecilia formosa 57.14 3.00e-35 139.00
IUUC-Pab-098533 Pongo abelii 57.14 3.00e-35 138.00
IUUC-Pop-099815 Populus trichocarpa 53.91 5.00e-34 134.00
IUUC-Pca-100783 Procavia capensis 45.38 6.00e-25 104.00
IUUC-Ppe-101410 Prunus persica 52.17 2.00e-33 132.00
IUUC-Pva-102901 Pteropus vampyrus 57.14 3.00e-35 138.00
IUUC-Pgr-103499 Puccinia graminis 47.12 3.00e-45 171.00
IUUC-Ptt-103874 Puccinia triticina 66.95 6.00e-43 165.00
IUUC-Pte-104224 Pyrenophora teres 58.65 3.00e-31 125.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 60.95 6.00e-32 127.00
IUUC-Rno-105499 Rattus norvegicus 57.14 3.00e-35 139.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 48.97 3.00e-50 188.00
IUUC-Spo-108033 Schizosaccharomyces pombe 50.00 6.00e-50 187.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 48.88 1.00e-44 169.00
IUUC-Smo-109307 Selaginella moellendorffii 40.00 4.00e-32 128.00
IUUC-Sit-110099 Setaria italica 53.33 4.00e-28 115.00
IUUC-Sly-111529 Solanum lycopersicum 41.49 7.00e-31 124.00
IUUC-Stu-111940 Solanum tuberosum 39.57 3.00e-30 121.00
IUUC-Sar-112973 Sorex araneus 58.49 1.00e-30 123.00
IUUC-Sbi-114394 Sorghum bicolor 51.24 2.00e-31 126.00
IUUC-Sre-115178 Sporisorium reilianum 48.17 3.00e-47 178.00
IUUC-Tgu-116474 Taeniopygia guttata 57.14 3.00e-35 138.00
IUUC-Tru-118429 Takifugu rubripes 57.14 3.00e-35 139.00
IUUC-Tsy-118896 Tarsius syrichta 57.14 3.00e-35 138.00
IUUC-Tni-119960 Tetraodon nigroviridis 57.14 3.00e-35 139.00
IUUC-Tca-121469 Theobroma cacao 54.17 9.00e-31 123.00
IUUC-Tre-122004 Trichoderma reesei 41.24 2.00e-35 139.00
IUUC-Tvi-122449 Trichoderma virens 41.24 2.00e-35 139.00
IUUC-Tae-125854 Triticum aestivum 57.63 3.00e-36 142.00
IUUC-Tur-126793 Triticum urartu 56.03 1.00e-33 133.00
IUUC-Tme-127078 Tuber melanosporum 48.19 8.00e-44 167.00
IUUC-Tbe-127720 Tupaia belangeri 57.14 3.00e-35 138.00
IUUC-Ttr-129035 Tursiops truncatus 57.14 3.00e-35 138.00
IUUC-Uma-129517 Ustilago maydis 47.12 8.00e-45 170.00
IUUC-Vda-129691 Verticillium dahliae 43.86 3.00e-37 145.00
IUUC-Vpa-130128 Vicugna pacos 57.14 3.00e-35 138.00
IUUC-Vvi-130876 Vitis vinifera 53.91 3.00e-33 132.00
IUUC-Xtr-132393 Xenopus tropicalis 57.14 3.00e-35 138.00
IUUC-Xma-133603 Xiphophorus maculatus 57.14 3.00e-35 139.00
IUUC-Yli-134499 Yarrowia lipolytica 50.26 2.00e-50 189.00
IUUC-Zma-135470 Zea mays 48.06 7.00e-26 107.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved