• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • GWASdb
    • OMIM
  • Drug & target
    • DrugBank
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bta-013158
UUCD1 version UUC-BoT-01005
Ensembl Protein ID ENSBTAP00000049292.1
UniProt Accession Q1RMX2; UB2D2_BOVIN
Genbank Protein ID AAI14655.1
Protein Name Ubiquitin-conjugating enzyme E2 D2; (E3-independent) E2 ubiquitin-conjugating enzyme D2; E2 ubiquitin-conjugating enzyme D2; Ubiquitin carrier protein D2; Ubiquitin-protein ligase D2
Genbank Nucleotide ID BC114654
Gene Name UBE2D3; UBE2D2; UBC4; UBCH4; UBCH5B
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000004161.5 ENSBTAT00000055723.1 ENSBTAP00000049292.1
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 6.50e-57 191.3 5 139
UBD/UBC-like/UBD_UBC 1.10e-85 284.8 5 142
Active Site
Position(s) Description Evidence
85 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkee 89
    R++kel++l++dpp+++sa+pv + d+++w+++i+Gp+d+pY+ggvF l+i+fp+dYPfkPPkv f+t+i+hPn+++nG++Cl+il+
   Q: 5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-- 90
    99**********************.9************************************************************9.. PP
   S: 90 ekWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    ++Wspal++++vllsi+sll++pnp++pl e+a+++k++re+y++++r
   Q: 91 SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAR 139
    *********************************************9987 PP
   


   UBD/UBC-like/UBD_UBC

   S: 1    rikkelkdllrdeeaqisadlvdddlfelratiagppdspyeggvffltiklptdypfkppkvafitkiyhpninsngsicldilrsqw 89
    ri+kel+dl+rd++aq+sa++v+dd+f+++ati+gp+dspy+ggvfflti++ptdypfkppkvaf+t+iyhpninsngsicldilrsqw
   Q: 5 RIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQW 93
    8**************************************************************************************** PP
   S: 90 saaltlskvllslcslladaepddplvaeiariyktdkekykriarewt 138
    s+alt+skvlls+csll+d++pddplv+eiariyktd+eky+riarewt
   Q: 94 SPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWT 142
    ************************************************8 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
Protein Sequence
(Fasta)
MALKRIHKEL NDLARDPPAQ CSAGPVGDDM FHWQATIMGP NDSPYQGGVF FLTIHFPTDY 60
PFKPPKVAFT TRIYHPNINS NGSICLDILR SQWSPALTIS KVLLSICSLL CDPNPDDPLV 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-013158|E2,E2/UBC;UBD,UBD_UBC|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CCCGCGCTCC GGCTGCCCCA CCCCGGCGGC GCCGCCCGCC CGCGCGTCTC TCGGTCCACC 60
TGCAGCAGGC AGTCCCTCCG GCTGTCCTAC CCAGAGCCGC CGGCCGAGCC CGAGGCCTGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-013158|E2,E2/UBC;UBD,UBD_UBC|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0070062--C:extracellular exosome
GO:0043234--C:protein complex
GO:0000151--C:ubiquitin ligase complex
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0004842--F:ubiquitin-protein transferase activity
GO:0051865--P:protein autoubiquitination
GO:0070936--P:protein K48-linked ubiquitination

KEGG bta:541003
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000292 Aegilops tauschii 79.59 2.00e-69 254.00
IUUC-Aml-001778 Ailuropoda melanoleuca 100.00 1.00e-81 294.00
IUUC-Atr-002861 Amborella trichopoda 80.95 2.00e-70 257.00
IUUC-Apl-003199 Anas platyrhynchos 100.00 3.00e-81 293.00
IUUC-Aca-005236 Anolis carolinensis 100.00 4.00e-86 309.00
IUUC-Aly-006221 Arabidopsis lyrata 80.95 6.00e-71 259.00
IUUC-Ath-007700 Arabidopsis thaliana 80.95 4.00e-70 256.00
IUUC-Ago-007967 Ashbya gossypii 80.95 2.00e-71 260.00
IUUC-Acl-008266 Aspergillus clavatus 85.03 4.00e-74 269.00
IUUC-Afl-008709 Aspergillus flavus 78.87 4.00e-68 252.00
IUUC-Afu-008956 Aspergillus fumigatus 85.71 2.00e-74 270.00
IUUC-Ani-009401 Aspergillus nidulans 83.67 7.00e-73 265.00
IUUC-Ang-009725 Aspergillus niger 84.80 4.00e-62 229.00
IUUC-Aor-010157 Aspergillus oryzae 84.35 1.00e-73 268.00
IUUC-Ate-010438 Aspergillus terreus 84.35 3.00e-73 266.00
IUUC-Ame-011831 Astyanax mexicanus 96.60 3.00e-83 300.00
IUUC-Bgr-012238 Blumeria graminis 80.27 1.00e-69 254.00
IUUC-Bci-013661 Botrytis cinerea 83.67 5.00e-74 269.00
IUUC-Bdi-014561 Brachypodium distachyon 80.27 9.00e-71 258.00
IUUC-Bol-015722 Brassica oleracea 81.63 6.00e-71 259.00
IUUC-Bra-017985 Brassica rapa 80.95 5.00e-71 259.00
IUUC-Cel-018362 Caenorhabditis elegans 93.88 1.00e-81 294.00
IUUC-Cja-019886 Callithrix jacchus 100.00 4.00e-86 309.00
IUUC-Cfa-020436 Canis familiaris 100.00 4.00e-86 309.00
IUUC-Cpo-021714 Cavia porcellus 97.96 2.00e-84 303.00
IUUC-Cre-022765 Chlamydomonas reinhardtii 78.91 3.00e-69 253.00
IUUC-Csa-023148 Chlorocebus sabaeus 95.27 5.00e-81 292.00
IUUC-Cin-025379 Ciona intestinalis 86.30 2.00e-76 277.00
IUUC-Csv-026311 Ciona savignyi 85.62 8.00e-73 265.00
IUUC-Cgl-026490 Colletotrichum gloeosporioides 84.35 9.00e-74 268.00
IUUC-Cne-026957 Cryptococcus neoformans 80.14 2.00e-69 254.00
IUUC-Dre-027758 Danio rerio 98.64 5.00e-85 305.00
IUUC-Dno-028952 Dasypus novemcinctus 100.00 7.00e-82 295.00
IUUC-Dor-030323 Dipodomys ordii 92.52 4.00e-81 292.00
IUUC-Dse-031397 Dothistroma septosporum 84.35 5.00e-74 269.00
IUUC-Dme-031594 Drosophila melanogaster 94.56 2.00e-81 293.00
IUUC-Ete-032295 Echinops telfairi 100.00 3.00e-81 293.00
IUUC-Eca-033293 Equus caballus 100.00 2.00e-81 294.00
IUUC-Eeu-034766 Erinaceus europaeus 96.43 3.00e-78 283.00
IUUC-Fca-035917 Felis catus 97.28 5.00e-84 302.00
IUUC-Fal-036904 Ficedula albicollis 97.86 2.00e-80 290.00
IUUC-Fox-038021 Fusarium oxysporum 84.35 1.00e-73 268.00
IUUC-Fso-038297 Fusarium solani 83.67 3.00e-73 266.00
IUUC-Gmo-038898 Gadus morhua 97.20 3.00e-81 293.00
IUUC-Ggr-039912 Gaeumannomyces graminis 79.61 2.00e-69 254.00
IUUC-Gga-040758 Gallus gallus 100.00 4.00e-86 309.00
IUUC-Gac-042231 Gasterosteus aculeatus 97.28 6.00e-84 302.00
IUUC-Gma-043733 Glycine max 80.27 1.00e-70 258.00
IUUC-Ggo-045375 Gorilla gorilla 95.95 3.00e-82 296.00
IUUC-Hsa-045885 Homo sapiens 100.00 4.00e-86 309.00
IUUC-Hvu-047546 Hordeum vulgare 78.23 5.00e-69 252.00
IUUC-Itr-048882 Ictidomys tridecemlineatus 96.62 3.00e-82 296.00
IUUC-Kpa-049290 Komagataella pastoris 78.23 8.00e-69 251.00
IUUC-Lch-050109 Latimeria chalumnae 86.39 3.00e-77 280.00
IUUC-Lpe-051289 Leersia perrieri 80.27 2.00e-70 257.00
IUUC-Loc-052838 Lepisosteus oculatus 93.20 2.00e-81 293.00
IUUC-Lma-053121 Leptosphaeria maculans 84.35 3.00e-74 270.00
IUUC-Laf-053580 Loxodonta africana 100.00 9.00e-82 295.00
IUUC-Mcc-054673 Macaca mulatta 100.00 2.00e-81 294.00
IUUC-Meu-056462 Macropus eugenii 96.40 1.00e-78 284.00
IUUC-Mor-057235 Magnaporthe oryzae 83.67 5.00e-73 266.00
IUUC-Mpo-057596 Magnaporthe poae 79.61 4.00e-69 253.00
IUUC-Mtr-058257 Medicago truncatula 80.27 9.00e-70 255.00
IUUC-Mla-059189 Melampsora laricipopulina 80.95 1.00e-68 251.00
IUUC-Mga-059237 Meleagris gallopavo 97.86 2.00e-80 290.00
IUUC-Mvi-060397 Microbotryum violaceum 82.31 6.00e-72 262.00
IUUC-Mmr-060889 Microcebus murinus 96.60 1.00e-83 301.00
IUUC-Mdo-062962 Monodelphis domestica 100.00 4.00e-86 309.00
IUUC-Mmu-063518 Mus musculus 100.00 4.00e-86 309.00
IUUC-Mac-065211 Musa acuminata 80.95 5.00e-70 256.00
IUUC-Mpu-066604 Mustela putorius furo 95.89 2.00e-82 296.00
IUUC-Nfi-068599 Neosartorya fischeri 85.71 2.00e-74 270.00
IUUC-Ncr-068677 Neurospora crassa 82.99 3.00e-72 263.00
IUUC-Nle-069715 Nomascus leucogenys 93.20 2.00e-81 293.00
IUUC-Opr-070191 Ochotona princeps 97.84 8.00e-80 288.00
IUUC-Ont-071766 Oreochromis niloticus 98.64 4.00e-85 306.00
IUUC-Oan-073026 Ornithorhynchus anatinus 92.86 2.00e-77 281.00
IUUC-Ocu-074315 Oryctolagus cuniculus 100.00 4.00e-86 309.00
IUUC-Oba-075411 Oryza barthii 80.27 3.00e-70 256.00
IUUC-Obr-076658 Oryza brachyantha 80.27 2.00e-70 257.00
IUUC-Ogl-076968 Oryza glaberrima 80.95 8.00e-71 258.00
IUUC-Ogu-078091 Oryza glumaepatula 80.00 1.00e-69 256.00
IUUC-Oin-079659 Oryza indica 80.95 8.00e-71 258.00
IUUC-Olo-080786 Oryza longistaminata 80.27 3.00e-70 256.00
IUUC-Ome-081920 Oryza meridionalis 80.95 2.00e-69 254.00
IUUC-Oni-082391 Oryza nivara 80.95 5.00e-71 261.00
IUUC-Opu-083833 Oryza punctata 80.27 2.00e-70 257.00
IUUC-Oru-085167 Oryza rufipogon 80.95 7.00e-71 260.00
IUUC-Osa-086003 Oryza sativa 80.95 8.00e-71 258.00
IUUC-Ola-086331 Oryzias latipes 98.64 4.00e-85 306.00
IUUC-Olu-087615 Ostreococcus lucimarinus 76.87 2.00e-65 241.00
IUUC-Oga-088477 Otolemur garnettii 94.52 8.00e-82 295.00
IUUC-Oar-090038 Ovis aries 97.28 5.00e-84 302.00
IUUC-Ptr-090707 Pan troglodytes 100.00 4.00e-86 309.00
IUUC-Pan-092143 Papio anubis 100.00 4.00e-86 309.00
IUUC-Psi-094076 Pelodiscus sinensis 97.28 5.00e-84 302.00
IUUC-Pma-094405 Petromyzon marinus 94.81 1.00e-75 274.00
IUUC-Pno-094765 Phaeosphaeria nodorum 84.35 3.00e-74 270.00
IUUC-Ppa-095177 Physcomitrella patens 80.95 3.00e-70 256.00
IUUC-Pfo-096753 Poecilia formosa 98.64 4.00e-85 306.00
IUUC-Pab-097764 Pongo abelii 100.00 4.00e-86 309.00
IUUC-Pop-098799 Populus trichocarpa 80.95 3.00e-70 256.00
IUUC-Ppe-101431 Prunus persica 81.63 9.00e-71 258.00
IUUC-Pgr-103381 Puccinia graminis 82.31 1.00e-69 256.00
IUUC-Ptt-103723 Puccinia triticina 77.86 2.00e-61 227.00
IUUC-Pte-104015 Pyrenophora teres 84.35 4.00e-74 269.00
IUUC-Pyt-104701 Pyrenophora triticirepentis 84.35 4.00e-74 269.00
IUUC-Rno-105498 Rattus norvegicus 97.28 5.00e-84 302.00
IUUC-Sce-106153 Saccharomyces cerevisiae 80.56 4.00e-70 256.00
IUUC-Sja-107729 Schizosaccharomyces japonicus 84.35 5.00e-73 266.00
IUUC-Spo-108032 Schizosaccharomyces pombe 84.35 3.00e-73 266.00
IUUC-Ssl-108443 Sclerotinia sclerotiorum 84.35 2.00e-74 270.00
IUUC-Smo-109317 Selaginella moellendorffii 80.95 8.00e-70 255.00
IUUC-Sit-109936 Setaria italica 79.59 2.00e-70 258.00
IUUC-Sly-111055 Solanum lycopersicum 81.63 1.00e-70 258.00
IUUC-Stu-112436 Solanum tuberosum 79.59 5.00e-71 259.00
IUUC-Sar-113302 Sorex araneus 100.00 3.00e-81 293.00
IUUC-Sbi-114840 Sorghum bicolor 80.95 6.00e-71 258.00
IUUC-Sre-115037 Sporisorium reilianum 80.56 1.00e-69 254.00
IUUC-Ssc-116154 Sus scrofa 93.88 3.00e-81 293.00
IUUC-Tgu-116727 Taeniopygia guttata 97.28 5.00e-84 302.00
IUUC-Tru-118272 Takifugu rubripes 98.64 1.00e-84 305.00
IUUC-Tsy-118832 Tarsius syrichta 90.48 2.00e-78 283.00
IUUC-Tni-120056 Tetraodon nigroviridis 98.64 1.00e-84 305.00
IUUC-Tca-121542 Theobroma cacao 79.59 9.00e-71 259.00
IUUC-Tre-122125 Trichoderma reesei 82.31 1.00e-71 261.00
IUUC-Tvi-122296 Trichoderma virens 82.31 1.00e-71 261.00
IUUC-Tae-123340 Triticum aestivum 81.63 7.00e-72 262.00
IUUC-Tur-126518 Triticum urartu 79.59 8.00e-70 256.00
IUUC-Tme-126912 Tuber melanosporum 81.63 1.00e-71 261.00
IUUC-Tbe-127609 Tupaia belangeri 100.00 1.00e-67 247.00
IUUC-Uma-129648 Ustilago maydis 81.63 1.00e-71 261.00
IUUC-Vda-129695 Verticillium dahliae 84.35 9.00e-74 268.00
IUUC-Vpa-130446 Vicugna pacos 99.29 2.00e-80 291.00
IUUC-Vvi-131016 Vitis vinifera 80.27 1.00e-70 258.00
IUUC-Xtr-132329 Xenopus tropicalis 100.00 4.00e-86 309.00
IUUC-Xma-133829 Xiphophorus maculatus 98.64 4.00e-85 306.00
IUUC-Yli-134353 Yarrowia lipolytica 78.91 6.00e-71 258.00
IUUC-Zma-135956 Zea mays 79.59 1.00e-69 254.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved