• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • miRecords
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • Disease
    • ClinVar
    • GWASdb
  • PTM
    • dbPAF
    • PhosphositePlus
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Ang-009703
Ensembl Protein ID CAK43937
UniProt Accession A2Q9N1; CREB_ASPNC
Genbank Protein ID CAK43937.1
Protein Name Probable ubiquitin carboxyl-terminal hydrolase creB; Carbon catabolite repression protein B; Deubiquitinating enzyme creB; Ubiquitin thioesterase creB; Ubiquitin-hydrolyzing enzyme creB; Ubiquitin-specific-processing protease creB
Genbank Nucleotide ID AM269976
Gene Name creB; An01g08470
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
An01g08470 CAK43937 CAK43937
Status Unreviewed
Classification
Family E-Value Score Start End
DUB/USP 4.70e-82 275.4 90 483
Active Site
Position(s) Description Evidence
66 Nucleophile ECO:0000255|PROSITE-ProRule:PRU10092,
ECO:0000255|PROSITE-ProRule:PRU10093}
419 Proton acceptor ECO:0000255|PROSITE-ProRule:PRU10092,
ECO:0000255|PROSITE-ProRule:PRU10093}
Domain Profile

   DUB/USP

   S: 18   cLsnipelrellle........kkkeklneenp.................................................................... 42
    cL+ ++re++l+ +
   Q: 90 CLYYSVPFREAVLNyptrtpieS---------Leaalaknlryqnfaanqeaeaqaekqrlanaqrpgappaqppkpedkdsseykkkialqslplletkn 181
    89999999999999555444440.........344455555566666666677888888999999999999999999999999999999999999999988 PP
   S: 43 ....kepkgellkslqklfeelw..kskkkavsprellkalkkeaeefsgyeqqDaqEflaflldqleeelkk...eknkpkeeeeeedkselsdeaeekk 134
    +++++l +sl+++fe+++ +s+ + v p+++l++l++e+e+f++ ++qDa+Efl+ +l+++ +++ ++ p ++++s+++++++ +k
   Q: 182 nagsYGMSESLFTSLKDIFESVVasQSRIGIVRPQHFLDVLRRENEMFRSAMHQDAHEFLNLVLNEVVANVEAeamKQPIPSLPPADTTDSSRQSISSGSK 282
    888889999*************98899999****************************************97765555555556666777788888999** PP
   S: 135 kkknkslisdlFqgqlksqikclecdnvssreepfldlslpvpgkeetkkeslqdcLesftkeeelegenkyycekckkkqeaekklklkklPevLilhLk 235
    + ++ ++++lF+g+l+s+++cl+c+nvs+r+e fldls+++++++ s+++cL++f++ee+l+++nk++c++c ++qeaek++k+k+lP++L lhLk
   Q: 283 TPNTTRWVHELFEGTLTSETQCLTCENVSQRDEIFLDLSVDLEQHS-----SVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALHLK 378
    **********************************************.....9************************************************* PP
   S: 236 RfsfseeqksrekinkkvefpleLdlspfctspeekqkekkkYeLiavvvHsG.slssGHYvayvknekgkWllfdDskVtevkeeevleetg.....sta 330
    Rf+++e+ ++ +k++ +v +p +L l f+t+++ ++ ++ YeL+avvvH G ++ +GHYv+++k ++++WllfdD+ V++v+++ v ++ g + a
   Q: 379 RFKYTEDLQRLQKLFHRVVYPYHLRL--FNTTDDAED-PDRLYELYAVVVHIGgGPYHGHYVSIIKTQDRGWLLFDDEMVEPVDKNYVRNFFGdkpglACA 476
    *********************88887..566645544.49**************************************************999******** PP
   S: 331 YvlfYkr 337
    YvlfY++
   Q: 477 YVLFYQE 483
    *****97 PP
   

Organism Aspergillus niger
Functional Description
(View)

Functional Description



     Ubiquitin thioesterase component of the regulatory network controlling carbon source utilization through ubiquitination and deubiquitination involving creA, creB, creC, creD and acrB. Deubiquitinates the creA catabolic repressor and the quinate permease qutD. Plays also a role in response to carbon starvation and the control of extracellular proteases activity (By similarity).
Ubiquitin thioesterase component of the regulatory network controlling carbon source utilization through ubiquitination and deubiquitination involving creA, creB, creC, creD and acrB. Deubiquitinates the creA catabolic repressor and the quinate permease qutD. Plays also a role in response to carbon starvation and the control of extracellular proteases activity (By similarity).
Protein Sequence
(Fasta)
MGSFLRSFRR DVGSSTPSVG ATPAKKEPLA LPITPLEKML QEMGSDSVRQ DGSDKFFGME 60
NVSWPILQPI PRFIGIANSG FSYSVRKYLC LYYSVPFREA VLNYPTRTPI ESLEAALAKN 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ang-009703|DUB,USP|Aspergillus niger
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGGGTCTT TTCTGAGGAG TTTCCGAAGA GATGTGGTAA GTCCTTCGAT TTGCTGGCTT 60
GGCCGCGCTT CTTTTGCCTT GAAGTATGCT GTGGCCTTCA ACGTCCTTGG GGCATATAAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ang-009703|DUB,USP|Aspergillus niger
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-0378--Hydrolase
KW-0645--Protease
KW-1185--Reference proteome
KW-0788--Thiol protease
KW-0833--Ubl conjugation pathway

Interpro

IPR001394--Peptidase_C19_UCH
IPR018200--USP_CS
IPR028889--USP_dom

PROSITE

PS00972--USP_1
PS00973--USP_2
PS50235--USP_3

Pfam

PF00443--UCH

Gene Ontology

GO:0036459--F:thiol-dependent ubiquitinyl hydrolase activity
GO:0045013--P:carbon catabolite repression of transcription
GO:0016579--P:protein deubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG ang:ANI_1_1130014
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000193 Aegilops tauschii 46.15 2.00e-81 294.00
IUUC-Aml-001964 Ailuropoda melanoleuca 49.49 9.00e-85 305.00
IUUC-Atr-002650 Amborella trichopoda 47.94 3.00e-81 293.00
IUUC-Apl-003411 Anas platyrhynchos 49.16 2.00e-84 303.00
IUUC-Aca-005212 Anolis carolinensis 49.83 1.00e-84 305.00
IUUC-Aly-005830 Arabidopsis lyrata 46.71 3.00e-76 276.00
IUUC-Ath-006663 Arabidopsis thaliana 47.51 3.00e-79 286.00
IUUC-Ago-007871 Ashbya gossypii 42.20 1.00e-65 243.00
IUUC-Acl-008239 Aspergillus clavatus 71.79 0.00e+00 838.00
IUUC-Afl-008602 Aspergillus flavus 74.90 0.00e+00 920.00
IUUC-Afu-008816 Aspergillus fumigatus 79.68 0.00e+00 809.00
IUUC-Ani-009137 Aspergillus nidulans 67.88 0.00e+00 823.00
IUUC-Aor-009901 Aspergillus oryzae 73.46 0.00e+00 840.00
IUUC-Ate-010431 Aspergillus terreus 71.84 0.00e+00 883.00
IUUC-Ame-011015 Astyanax mexicanus 50.17 2.00e-85 307.00
IUUC-Bgr-012071 Blumeria graminis 53.37 9.00e-148 515.00
IUUC-Bta-012981 Bos taurus 49.83 3.00e-85 306.00
IUUC-Bci-013837 Botrytis cinerea 52.21 5.00e-154 536.00
IUUC-Bdi-014008 Brachypodium distachyon 47.08 1.00e-80 291.00
IUUC-Bol-015138 Brassica oleracea 47.51 5.00e-77 279.00
IUUC-Bra-016956 Brassica rapa 48.03 2.00e-79 287.00
IUUC-Cel-018379 Caenorhabditis elegans 40.77 7.00e-73 265.00
IUUC-Cja-018831 Callithrix jacchus 50.17 3.00e-85 306.00
IUUC-Cfa-020534 Canis familiaris 49.16 3.00e-84 303.00
IUUC-Cpo-021703 Cavia porcellus 50.17 7.00e-85 305.00
IUUC-Cre-022711 Chlamydomonas reinhardtii 45.21 2.00e-65 241.00
IUUC-Csa-023841 Chlorocebus sabaeus 47.14 2.00e-80 291.00
IUUC-Cho-024902 Choloepus hoffmanni 38.38 7.00e-56 209.00
IUUC-Cin-025659 Ciona intestinalis 39.22 3.00e-69 253.00
IUUC-Csv-025828 Ciona savignyi 55.33 1.00e-63 235.00
IUUC-Cgl-026611 Colletotrichum gloeosporioides 54.77 2.00e-155 540.00
IUUC-Cne-026900 Cryptococcus neoformans 40.51 1.00e-65 242.00
IUUC-Cme-027339 Cyanidioschyzon merolae 31.97 5.00e-34 137.00
IUUC-Dre-027845 Danio rerio 50.51 4.00e-86 309.00
IUUC-Dno-029460 Dasypus novemcinctus 49.16 4.00e-84 303.00
IUUC-Dor-030972 Dipodomys ordii 50.97 4.00e-74 269.00
IUUC-Dse-031470 Dothistroma septosporum 48.72 8.00e-157 545.00
IUUC-Dme-032038 Drosophila melanogaster 57.07 2.00e-68 250.00
IUUC-Ete-032659 Echinops telfairi 54.24 8.00e-55 205.00
IUUC-Eca-033439 Equus caballus 49.49 7.00e-85 305.00
IUUC-Eeu-034916 Erinaceus europaeus 47.43 9.00e-66 241.00
IUUC-Fca-035524 Felis catus 48.82 3.00e-84 303.00
IUUC-Fal-036833 Ficedula albicollis 49.16 2.00e-84 304.00
IUUC-Fox-037682 Fusarium oxysporum 57.08 6.00e-151 526.00
IUUC-Fso-038299 Fusarium solani 55.18 5.00e-150 523.00
IUUC-Gmo-038763 Gadus morhua 50.17 1.00e-84 305.00
IUUC-Ggr-039806 Gaeumannomyces graminis 57.06 8.00e-155 538.00
IUUC-Gga-041151 Gallus gallus 49.16 3.00e-84 303.00
IUUC-Gac-041967 Gasterosteus aculeatus 50.51 1.00e-84 304.00
IUUC-Gma-043101 Glycine max 47.74 8.00e-82 295.00
IUUC-Ggo-044659 Gorilla gorilla 47.14 2.00e-80 290.00
IUUC-Hsa-045700 Homo sapiens 50.17 3.00e-85 306.00
IUUC-Hvu-047692 Hordeum vulgare 46.93 5.00e-80 289.00
IUUC-Itr-049082 Ictidomys tridecemlineatus 49.49 8.00e-85 305.00
IUUC-Kpa-049250 Komagataella pastoris 51.08 3.00e-95 340.00
IUUC-Lch-050435 Latimeria chalumnae 49.83 3.00e-83 300.00
IUUC-Lpe-051368 Leersia perrieri 45.54 4.00e-78 283.00
IUUC-Loc-051968 Lepisosteus oculatus 49.16 2.00e-84 304.00
IUUC-Lma-053300 Leptosphaeria maculans 54.18 8.00e-168 582.00
IUUC-Laf-053887 Loxodonta africana 49.49 8.00e-85 305.00
IUUC-Mcc-055701 Macaca mulatta 50.17 4.00e-85 306.00
IUUC-Mor-057072 Magnaporthe oryzae 58.17 4.00e-156 543.00
IUUC-Mpo-057424 Magnaporthe poae 57.11 2.00e-154 538.00
IUUC-Mtr-057715 Medicago truncatula 47.78 8.00e-81 291.00
IUUC-Mla-059142 Melampsora laricipopulina 55.63 2.00e-100 358.00
IUUC-Mga-059195 Meleagris gallopavo 49.16 4.00e-84 303.00
IUUC-Mvi-060357 Microbotryum violaceum 54.39 2.00e-84 305.00
IUUC-Mmr-060751 Microcebus murinus 49.49 8.00e-85 305.00
IUUC-Mdo-062735 Monodelphis domestica 49.49 8.00e-85 305.00
IUUC-Mmu-063263 Mus musculus 49.83 3.00e-84 303.00
IUUC-Mac-065323 Musa acuminata 48.04 3.00e-79 286.00
IUUC-Mpu-066038 Mustela putorius furo 47.14 8.00e-81 292.00
IUUC-Mlu-068128 Myotis lucifugus 49.49 7.00e-85 305.00
IUUC-Nfi-068611 Neosartorya fischeri 70.95 0.00e+00 816.00
IUUC-Ncr-068699 Neurospora crassa 55.45 3.00e-158 550.00
IUUC-Nle-069767 Nomascus leucogenys 50.17 3.00e-85 306.00
IUUC-Opr-070980 Ochotona princeps 47.14 2.00e-80 290.00
IUUC-Ont-072658 Oreochromis niloticus 50.51 1.00e-84 305.00
IUUC-Oan-073372 Ornithorhynchus anatinus 48.82 2.00e-83 300.00
IUUC-Ocu-074322 Oryctolagus cuniculus 49.83 1.00e-84 305.00
IUUC-Oba-075220 Oryza barthii 45.54 3.00e-78 283.00
IUUC-Obr-076208 Oryza brachyantha 46.91 9.00e-75 271.00
IUUC-Ogl-077216 Oryza glaberrima 45.54 3.00e-78 283.00
IUUC-Ogu-078836 Oryza glumaepatula 45.54 3.00e-78 283.00
IUUC-Oin-079522 Oryza indica 45.54 3.00e-78 283.00
IUUC-Olo-080882 Oryza longistaminata 45.54 3.00e-78 283.00
IUUC-Ome-081549 Oryza meridionalis 45.54 3.00e-78 283.00
IUUC-Oni-082982 Oryza nivara 45.54 3.00e-78 283.00
IUUC-Opu-083532 Oryza punctata 45.54 4.00e-78 283.00
IUUC-Oru-084568 Oryza rufipogon 45.54 3.00e-78 283.00
IUUC-Osa-085299 Oryza sativa 45.54 3.00e-78 283.00
IUUC-Ola-087418 Oryzias latipes 50.51 9.00e-85 305.00
IUUC-Olu-087809 Ostreococcus lucimarinus 45.45 8.00e-65 238.00
IUUC-Oga-088298 Otolemur garnettii 49.49 1.00e-84 304.00
IUUC-Oar-090269 Ovis aries 49.83 9.00e-85 305.00
IUUC-Ptr-090467 Pan troglodytes 50.17 3.00e-85 306.00
IUUC-Pan-092437 Papio anubis 50.00 5.00e-84 302.00
IUUC-Psi-092993 Pelodiscus sinensis 48.82 1.00e-84 304.00
IUUC-Pma-094388 Petromyzon marinus 47.83 2.00e-81 294.00
IUUC-Pno-095044 Phaeosphaeria nodorum 56.97 2.00e-165 574.00
IUUC-Ppa-095275 Physcomitrella patens 49.50 7.00e-84 301.00
IUUC-Pfo-097052 Poecilia formosa 50.51 1.00e-84 305.00
IUUC-Pab-097797 Pongo abelii 50.17 3.00e-85 306.00
IUUC-Pop-099016 Populus trichocarpa 48.25 1.00e-82 298.00
IUUC-Pca-100835 Procavia capensis 51.05 2.00e-69 253.00
IUUC-Ppe-101474 Prunus persica 48.10 1.00e-81 295.00
IUUC-Pva-102878 Pteropus vampyrus 48.81 3.00e-83 300.00
IUUC-Pgr-103306 Puccinia graminis 54.75 8.00e-103 367.00
IUUC-Pte-104356 Pyrenophora teres 53.48 3.00e-167 580.00
IUUC-Pyt-104709 Pyrenophora triticirepentis 52.51 3.00e-151 527.00
IUUC-Rno-106060 Rattus norvegicus 50.17 1.00e-84 304.00
IUUC-Sce-106367 Saccharomyces cerevisiae 41.59 4.00e-72 264.00
IUUC-Sha-107087 Sarcophilus harrisii 49.49 8.00e-85 305.00
IUUC-Sja-107684 Schizosaccharomyces japonicus 55.22 2.00e-89 321.00
IUUC-Spo-108095 Schizosaccharomyces pombe 45.15 3.00e-101 360.00
IUUC-Smo-108674 Selaginella moellendorffii 49.66 4.00e-84 303.00
IUUC-Sit-110819 Setaria italica 46.50 1.00e-80 291.00
IUUC-Sly-111210 Solanum lycopersicum 48.06 8.00e-81 291.00
IUUC-Stu-112398 Solanum tuberosum 48.16 6.00e-80 288.00
IUUC-Sar-113216 Sorex araneus 48.48 3.00e-82 296.00
IUUC-Sbi-114724 Sorghum bicolor 47.40 2.00e-82 297.00
IUUC-Sre-115197 Sporisorium reilianum 57.14 9.00e-94 336.00
IUUC-Ssc-116321 Sus scrofa 49.49 2.00e-85 307.00
IUUC-Tgu-117482 Taeniopygia guttata 50.17 4.00e-83 299.00
IUUC-Tru-118613 Takifugu rubripes 50.51 9.00e-85 305.00
IUUC-Tsy-119520 Tarsius syrichta 53.23 6.00e-59 218.00
IUUC-Tni-120293 Tetraodon nigroviridis 50.51 9.00e-85 305.00
IUUC-Tca-121329 Theobroma cacao 49.50 1.00e-81 294.00
IUUC-Tre-122226 Trichoderma reesei 50.65 2.00e-155 540.00
IUUC-Tvi-122330 Trichoderma virens 56.69 2.00e-156 544.00
IUUC-Tae-124807 Triticum aestivum 47.25 4.00e-82 296.00
IUUC-Tur-126563 Triticum urartu 47.25 2.00e-82 297.00
IUUC-Tme-126890 Tuber melanosporum 67.26 1.00e-136 478.00
IUUC-Tbe-127783 Tupaia belangeri 49.49 7.00e-85 305.00
IUUC-Ttr-129083 Tursiops truncatus 49.83 3.00e-85 306.00
IUUC-Uma-129409 Ustilago maydis 56.14 3.00e-94 338.00
IUUC-Vda-129736 Verticillium dahliae 50.84 2.00e-138 484.00
IUUC-Vpa-130391 Vicugna pacos 47.14 1.00e-75 274.00
IUUC-Vvi-131371 Vitis vinifera 48.54 4.00e-83 299.00
IUUC-Xtr-132082 Xenopus tropicalis 48.48 1.00e-81 295.00
IUUC-Xma-133475 Xiphophorus maculatus 50.51 1.00e-84 305.00
IUUC-Yli-134632 Yarrowia lipolytica 59.94 9.00e-125 439.00
IUUC-Zma-134951 Zea mays 46.75 6.00e-81 292.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved