• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
iUUCD ID IUUC-Ggr-039875
Ensembl Protein ID GGTG_02738T0
UniProt Accession J3NN80; J3NN80_GAGT3
Genbank Protein ID EJT77632.1
Protein Name Ubiquitin-conjugating enzyme E2 2
Genbank Nucleotide ID ADBI01000261
Gene Name GGTG_02738
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
GGTG_02738 GGTG_02738T0 GGTG_02738T0
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 2.00e-52 176.2 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspals 97
    Rl++++k++++dpp+g+sa+pv + ++++w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP+vkf++++fhPnvy++G++Cl+il+ ++Wsp+++
   Q: 8 RLMRDFKRMQTDPPAGVSASPVPD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPSVKFISQMFHPNVYATGELCLDILQ--NRWSPTYD 101
    9***********************.9************************************************************9..******** PP
   S: 98 vesvllsiqsllaepnpesplneeaaellkknreeykkkvre 139
    v+ vl+siqsll++pn+ sp+n+ea++l+k+nr+ey k+vre
   Q: 102 VAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRKEYYKRVRE 143
    ***************************************985 PP
   

Organism Gaeumannomyces graminis
Protein Sequence
(Fasta)
MSTAARRRLM RDFKRMQTDP PAGVSASPVP DNVMTWNAVI IGPADTPFED GTFRLVMHFE 60
EQYPNKPPSV KFISQMFHPN VYATGELCLD ILQNRWSPTY DVAAVLTSIQ SLLNDPNTGS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ggr-039875|E2,E2/UBC|Gaeumannomyces graminis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CCCGCTTAGC TCCGATCGCC GCTTTACCAA TCCAGACCTT CCGCCCCGTT TGTCCATGAG 60
CACACGCTCA ACCAAGGTTC CCCTCATATA AAGTGCTGTT TCCGCCACCA AGCCAGTAAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ggr-039875|E2,E2/UBC|Gaeumannomyces graminis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 63.82 5.00e-61 224.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.13 7.00e-64 234.00
IUUC-Atr-002862 Amborella trichopoda 65.79 3.00e-62 228.00
IUUC-Apl-004063 Anas platyrhynchos 61.64 2.00e-53 199.00
IUUC-Aca-005001 Anolis carolinensis 68.46 9.00e-64 233.00
IUUC-Aly-005584 Arabidopsis lyrata 65.13 1.00e-61 226.00
IUUC-Ath-007149 Arabidopsis thaliana 65.13 1.00e-61 226.00
IUUC-Ago-007745 Ashbya gossypii 77.33 3.00e-71 259.00
IUUC-Acl-008139 Aspergillus clavatus 94.67 5.00e-84 301.00
IUUC-Afl-008551 Aspergillus flavus 95.33 1.00e-84 302.00
IUUC-Afu-008980 Aspergillus fumigatus 95.33 1.00e-84 302.00
IUUC-Ang-009554 Aspergillus niger 95.33 1.00e-84 302.00
IUUC-Aor-010242 Aspergillus oryzae 95.33 1.00e-84 302.00
IUUC-Ate-010390 Aspergillus terreus 95.33 1.00e-84 302.00
IUUC-Ame-010743 Astyanax mexicanus 69.80 3.00e-64 235.00
IUUC-Bgr-012039 Blumeria graminis 93.33 6.00e-74 267.00
IUUC-Bta-012840 Bos taurus 69.13 7.00e-64 234.00
IUUC-Bci-013919 Botrytis cinerea 94.74 3.00e-84 301.00
IUUC-Bdi-015010 Brachypodium distachyon 65.79 8.00e-62 227.00
IUUC-Bol-016245 Brassica oleracea 65.13 8.00e-62 227.00
IUUC-Bra-018026 Brassica rapa 65.13 8.00e-62 227.00
IUUC-Cel-018244 Caenorhabditis elegans 69.80 4.00e-65 238.00
IUUC-Cja-019737 Callithrix jacchus 69.13 7.00e-64 234.00
IUUC-Cfa-020244 Canis familiaris 69.13 7.00e-64 234.00
IUUC-Cpo-021323 Cavia porcellus 69.80 6.00e-64 234.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 68.22 9.00e-53 197.00
IUUC-Csa-023430 Chlorocebus sabaeus 69.13 7.00e-64 234.00
IUUC-Cho-024773 Choloepus hoffmanni 54.36 6.00e-44 167.00
IUUC-Cin-025537 Ciona intestinalis 69.13 5.00e-54 201.00
IUUC-Csv-025846 Ciona savignyi 69.13 2.00e-57 213.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 98.00 3.00e-86 308.00
IUUC-Cne-026864 Cryptococcus neoformans 71.81 3.00e-66 242.00
IUUC-Cme-027284 Cyanidioschyzon merolae 63.33 7.00e-50 188.00
IUUC-Dre-027775 Danio rerio 69.13 3.00e-64 235.00
IUUC-Dno-029661 Dasypus novemcinctus 69.13 7.00e-64 234.00
IUUC-Dor-030452 Dipodomys ordii 66.42 2.00e-55 205.00
IUUC-Dse-031487 Dothistroma septosporum 94.67 2.00e-84 302.00
IUUC-Dme-031863 Drosophila melanogaster 70.47 6.00e-64 234.00
IUUC-Ete-032595 Echinops telfairi 67.79 1.00e-62 230.00
IUUC-Eca-033377 Equus caballus 69.13 7.00e-64 234.00
IUUC-Eeu-035191 Erinaceus europaeus 54.97 2.00e-43 166.00
IUUC-Fca-036336 Felis catus 69.13 7.00e-64 234.00
IUUC-Fal-037474 Ficedula albicollis 68.10 1.00e-48 182.00
IUUC-Fox-037808 Fusarium oxysporum 98.00 4.00e-86 307.00
IUUC-Fso-038232 Fusarium solani 97.33 1.00e-85 306.00
IUUC-Gmo-038517 Gadus morhua 69.13 9.00e-64 233.00
IUUC-Gga-040494 Gallus gallus 69.13 7.00e-64 234.00
IUUC-Gac-042471 Gasterosteus aculeatus 69.13 3.00e-64 235.00
IUUC-Gma-044057 Glycine max 65.79 2.00e-62 229.00
IUUC-Ggo-044896 Gorilla gorilla 69.13 9.00e-64 233.00
IUUC-Hsa-046239 Homo sapiens 69.13 7.00e-64 234.00
IUUC-Hvu-047054 Hordeum vulgare 63.82 5.00e-61 224.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 69.13 7.00e-64 234.00
IUUC-Kpa-049225 Komagataella pastoris 82.55 6.00e-75 271.00
IUUC-Lch-049964 Latimeria chalumnae 69.13 9.00e-64 233.00
IUUC-Lpe-051301 Leersia perrieri 65.79 4.00e-62 228.00
IUUC-Loc-051962 Lepisosteus oculatus 70.47 1.00e-64 236.00
IUUC-Laf-053380 Loxodonta africana 69.13 7.00e-64 234.00
IUUC-Mcc-054819 Macaca mulatta 69.13 5.00e-64 234.00
IUUC-Meu-056231 Macropus eugenii 69.13 9.00e-64 233.00
IUUC-Mor-057087 Magnaporthe oryzae 97.10 4.00e-79 284.00
IUUC-Mpo-057498 Magnaporthe poae 100.00 2.00e-90 323.00
IUUC-Mtr-058305 Medicago truncatula 65.79 3.00e-62 229.00
IUUC-Mla-058876 Melampsora laricipopulina 75.84 5.00e-64 234.00
IUUC-Mga-059863 Meleagris gallopavo 65.69 4.00e-56 208.00
IUUC-Mvi-060330 Microbotryum violaceum 73.86 7.00e-62 227.00
IUUC-Mmr-060630 Microcebus murinus 69.13 7.00e-64 234.00
IUUC-Mdo-062676 Monodelphis domestica 69.13 7.00e-64 234.00
IUUC-Mmu-063491 Mus musculus 69.13 7.00e-64 234.00
IUUC-Mac-064774 Musa acuminata 65.79 5.00e-62 228.00
IUUC-Mpu-065803 Mustela putorius furo 69.13 7.00e-64 234.00
IUUC-Mlu-067147 Myotis lucifugus 69.13 7.00e-64 234.00
IUUC-Nfi-068580 Neosartorya fischeri 95.33 1.00e-84 302.00
IUUC-Ncr-068913 Neurospora crassa 98.67 2.00e-87 311.00
IUUC-Nle-070105 Nomascus leucogenys 69.13 7.00e-64 234.00
IUUC-Opr-070935 Ochotona princeps 69.13 7.00e-64 234.00
IUUC-Ont-071335 Oreochromis niloticus 69.13 3.00e-64 235.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.89 8.00e-57 210.00
IUUC-Ocu-074130 Oryctolagus cuniculus 69.13 7.00e-64 234.00
IUUC-Oba-075896 Oryza barthii 65.79 1.00e-61 226.00
IUUC-Obr-076770 Oryza brachyantha 66.45 4.00e-62 228.00
IUUC-Ogl-077116 Oryza glaberrima 65.79 4.00e-62 228.00
IUUC-Ogu-078696 Oryza glumaepatula 65.79 4.00e-62 228.00
IUUC-Oin-079099 Oryza indica 65.79 4.00e-62 228.00
IUUC-Olo-081018 Oryza longistaminata 55.76 2.00e-51 193.00
IUUC-Ome-081285 Oryza meridionalis 65.79 4.00e-62 228.00
IUUC-Oni-082088 Oryza nivara 65.79 4.00e-62 228.00
IUUC-Opu-083310 Oryza punctata 65.79 4.00e-62 228.00
IUUC-Oru-084449 Oryza rufipogon 65.79 4.00e-62 228.00
IUUC-Osa-085923 Oryza sativa 65.79 4.00e-62 228.00
IUUC-Ola-087160 Oryzias latipes 69.13 3.00e-64 235.00
IUUC-Olu-087830 Ostreococcus lucimarinus 65.77 4.00e-53 198.00
IUUC-Oga-088836 Otolemur garnettii 69.13 7.00e-64 234.00
IUUC-Oar-090141 Ovis aries 69.13 7.00e-64 234.00
IUUC-Ptr-091453 Pan troglodytes 69.13 7.00e-64 234.00
IUUC-Pan-092511 Papio anubis 69.13 7.00e-64 234.00
IUUC-Psi-094094 Pelodiscus sinensis 69.13 9.00e-64 233.00
IUUC-Pma-094376 Petromyzon marinus 69.13 2.00e-63 233.00
IUUC-Pno-094935 Phaeosphaeria nodorum 94.00 5.00e-83 297.00
IUUC-Ppa-095689 Physcomitrella patens 65.79 7.00e-53 197.00
IUUC-Pfo-096784 Poecilia formosa 68.46 2.00e-63 233.00
IUUC-Pab-098121 Pongo abelii 69.13 7.00e-64 234.00
IUUC-Pop-099734 Populus trichocarpa 65.79 2.00e-56 209.00
IUUC-Pca-100906 Procavia capensis 63.76 4.00e-57 211.00
IUUC-Ppe-101949 Prunus persica 65.79 4.00e-62 229.00
IUUC-Pva-102380 Pteropus vampyrus 68.46 1.00e-61 226.00
IUUC-Pgr-103611 Puccinia graminis 75.84 2.00e-64 236.00
IUUC-Ptt-103971 Puccinia triticina 78.45 1.00e-48 183.00
IUUC-Pte-104378 Pyrenophora teres 94.00 1.00e-83 299.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 94.00 1.00e-83 299.00
IUUC-Rno-105772 Rattus norvegicus 69.13 5.00e-64 234.00
IUUC-Sce-106283 Saccharomyces cerevisiae 77.33 2.00e-71 259.00
IUUC-Sha-107650 Sarcophilus harrisii 68.46 1.00e-62 229.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 82.12 8.00e-67 243.00
IUUC-Spo-108073 Schizosaccharomyces pombe 82.12 8.00e-67 243.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 94.74 3.00e-84 301.00
IUUC-Smo-109512 Selaginella moellendorffii 65.79 1.00e-61 226.00
IUUC-Sit-110731 Setaria italica 65.79 4.00e-62 228.00
IUUC-Sly-111506 Solanum lycopersicum 65.79 2.00e-62 229.00
IUUC-Stu-112080 Solanum tuberosum 65.79 2.00e-62 229.00
IUUC-Sar-113429 Sorex araneus 69.13 7.00e-64 234.00
IUUC-Sbi-114289 Sorghum bicolor 65.79 4.00e-62 228.00
IUUC-Sre-115106 Sporisorium reilianum 72.37 1.00e-61 227.00
IUUC-Ssc-116265 Sus scrofa 69.13 9.00e-64 233.00
IUUC-Tgu-117383 Taeniopygia guttata 69.13 9.00e-64 233.00
IUUC-Tru-118576 Takifugu rubripes 68.46 2.00e-63 233.00
IUUC-Tsy-119000 Tarsius syrichta 69.13 7.00e-64 234.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.46 2.00e-63 233.00
IUUC-Tca-121827 Theobroma cacao 66.45 2.00e-62 229.00
IUUC-Tre-122002 Trichoderma reesei 96.67 1.00e-85 306.00
IUUC-Tvi-122331 Trichoderma virens 96.67 1.00e-85 306.00
IUUC-Tae-124461 Triticum aestivum 65.13 2.00e-61 227.00
IUUC-Tur-126866 Triticum urartu 64.47 2.00e-61 225.00
IUUC-Tme-127148 Tuber melanosporum 94.04 5.00e-85 304.00
IUUC-Tbe-127921 Tupaia belangeri 67.11 2.00e-59 219.00
IUUC-Ttr-129121 Tursiops truncatus 69.13 7.00e-64 234.00
IUUC-Uma-129561 Ustilago maydis 72.37 7.00e-62 228.00
IUUC-Vda-129711 Verticillium dahliae 98.00 3.00e-86 308.00
IUUC-Vpa-130570 Vicugna pacos 61.19 1.00e-49 186.00
IUUC-Vvi-131108 Vitis vinifera 65.79 1.00e-62 230.00
IUUC-Xtr-131824 Xenopus tropicalis 69.13 5.00e-64 234.00
IUUC-Xma-133667 Xiphophorus maculatus 69.13 3.00e-64 235.00
IUUC-Yli-134660 Yarrowia lipolytica 83.89 4.00e-76 274.00
IUUC-Zma-135584 Zea mays 64.47 2.00e-61 226.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved