• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • BioGRID
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Fca-035491
Ensembl Protein ID ENSFCAP00000019752.1
UniProt Accession M3WZG1; M3WZG1_FELCA
Genbank Protein ID ENSFCAP00000019752
Protein Name Uncharacterized protein
Genbank Nucleotide ID AANG02169656
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSFCAG00000028742.1 ENSFCAT00000024585.1 ENSFCAP00000019752.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 6.70e-68 227.0 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk++skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp++g++ynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYKGNIYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Felis catus
Protein Sequence
(Fasta)
MAVSESQLKK MVSKYKYRDL TVRETVNVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP 60
VPYKGNIYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Fca-035491|UBD,UBD_UEV|Felis catus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGGGGTGGGG GGCTGGCTAC TAGGTGTGTG ATTGTGTGGG GCGGCCTGGG GCGGCCCCGG 60
AGCGGCTGAC CCTCTGCCTG CGGGGACGGG AGTCGCCAGG CGGCCGCCAT GGCGGTGTCA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Fca-035491|UBD,UBD_UEV|Felis catus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 37.19 2.00e-20 93.60
IUUC-Aml-002415 Ailuropoda melanoleuca 98.72 0.00e+00 736.00
IUUC-Atr-002875 Amborella trichopoda 29.12 1.00e-35 144.00
IUUC-Apl-003473 Anas platyrhynchos 86.99 0.00e+00 674.00
IUUC-Aca-004573 Anolis carolinensis 89.29 0.00e+00 665.00
IUUC-Aly-006164 Arabidopsis lyrata 43.14 2.00e-21 96.30
IUUC-Ath-006575 Arabidopsis thaliana 43.14 2.00e-21 96.70
IUUC-Ago-007755 Ashbya gossypii 25.00 2.00e-05 43.50
IUUC-Acl-008218 Aspergillus clavatus 37.98 2.00e-25 110.00
IUUC-Afl-008597 Aspergillus flavus 38.35 2.00e-25 110.00
IUUC-Afu-009017 Aspergillus fumigatus 37.21 2.00e-23 103.00
IUUC-Ani-009468 Aspergillus nidulans 37.88 3.00e-21 96.70
IUUC-Ang-009755 Aspergillus niger 35.71 1.00e-22 101.00
IUUC-Aor-010072 Aspergillus oryzae 36.84 1.00e-25 110.00
IUUC-Ate-010400 Aspergillus terreus 37.98 4.00e-25 109.00
IUUC-Ame-011620 Astyanax mexicanus 79.49 0.00e+00 640.00
IUUC-Bgr-012136 Blumeria graminis 34.31 8.00e-23 101.00
IUUC-Bta-012557 Bos taurus 96.93 0.00e+00 717.00
IUUC-Bci-013881 Botrytis cinerea 35.29 3.00e-25 109.00
IUUC-Bdi-014325 Brachypodium distachyon 32.11 3.00e-14 72.80
IUUC-Bol-016308 Brassica oleracea 40.80 3.00e-26 113.00
IUUC-Bra-017605 Brassica rapa 40.32 3.00e-26 112.00
IUUC-Cel-018697 Caenorhabditis elegans 49.61 1.00e-37 150.00
IUUC-Cja-018963 Callithrix jacchus 90.31 0.00e+00 713.00
IUUC-Cfa-020472 Canis familiaris 98.72 0.00e+00 735.00
IUUC-Cpo-022001 Cavia porcellus 97.95 0.00e+00 731.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 30.11 9.00e-32 131.00
IUUC-Csa-023959 Chlorocebus sabaeus 97.44 0.00e+00 697.00
IUUC-Cho-024389 Choloepus hoffmanni 55.45 8.00e-38 151.00
IUUC-Cin-025688 Ciona intestinalis 44.53 9.00e-99 353.00
IUUC-Cne-026904 Cryptococcus neoformans 29.19 2.00e-14 74.30
IUUC-Cme-027280 Cyanidioschyzon merolae 38.18 3.00e-17 82.40
IUUC-Dre-027913 Danio rerio 79.49 9.00e-176 609.00
IUUC-Dno-029672 Dasypus novemcinctus 96.42 0.00e+00 736.00
IUUC-Dor-030175 Dipodomys ordii 96.00 2.00e-92 332.00
IUUC-Dse-031375 Dothistroma septosporum 31.39 3.00e-22 99.80
IUUC-Dme-031736 Drosophila melanogaster 49.26 8.00e-96 343.00
IUUC-Ete-032343 Echinops telfairi 91.30 0.00e+00 691.00
IUUC-Eca-033926 Equus caballus 97.95 0.00e+00 727.00
IUUC-Eeu-034940 Erinaceus europaeus 90.28 0.00e+00 717.00
IUUC-Fal-037508 Ficedula albicollis 89.80 0.00e+00 670.00
IUUC-Fox-037937 Fusarium oxysporum 30.77 2.00e-20 93.60
IUUC-Fso-038091 Fusarium solani 34.56 4.00e-24 105.00
IUUC-Gmo-039427 Gadus morhua 77.63 5.00e-172 597.00
IUUC-Ggr-039724 Gaeumannomyces graminis 35.82 4.00e-24 106.00
IUUC-Gga-040998 Gallus gallus 87.47 0.00e+00 696.00
IUUC-Gac-041356 Gasterosteus aculeatus 79.95 0.00e+00 639.00
IUUC-Gma-043566 Glycine max 38.89 8.00e-25 107.00
IUUC-Ggo-044967 Gorilla gorilla 97.44 0.00e+00 697.00
IUUC-Hsa-046686 Homo sapiens 97.44 0.00e+00 697.00
IUUC-Hvu-047430 Hordeum vulgare 37.19 1.00e-20 94.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 97.77 2.00e-109 387.00
IUUC-Kpa-049287 Komagataella pastoris 30.25 4.00e-15 75.50
IUUC-Lch-050597 Latimeria chalumnae 85.97 0.00e+00 673.00
IUUC-Lpe-051090 Leersia perrieri 38.02 3.00e-20 92.80
IUUC-Loc-052399 Lepisosteus oculatus 80.05 5.00e-178 616.00
IUUC-Lma-053249 Leptosphaeria maculans 28.07 9.00e-13 68.60
IUUC-Laf-053766 Loxodonta africana 97.19 0.00e+00 728.00
IUUC-Mcc-055641 Macaca mulatta 97.44 0.00e+00 697.00
IUUC-Meu-055919 Macropus eugenii 89.57 1.00e-169 588.00
IUUC-Mor-056970 Magnaporthe oryzae 36.92 3.00e-23 103.00
IUUC-Mpo-057345 Magnaporthe poae 35.38 6.00e-22 98.60
IUUC-Mtr-058436 Medicago truncatula 37.30 2.00e-25 109.00
IUUC-Mla-059037 Melampsora laricipopulina 35.17 4.00e-25 109.00
IUUC-Mga-059263 Meleagris gallopavo 87.01 0.00e+00 670.00
IUUC-Mvi-060463 Microbotryum violaceum 30.32 6.00e-17 82.40
IUUC-Mmr-060915 Microcebus murinus 97.19 0.00e+00 723.00
IUUC-Mdo-062449 Monodelphis domestica 93.35 0.00e+00 689.00
IUUC-Mmu-063151 Mus musculus 94.12 0.00e+00 699.00
IUUC-Mac-065020 Musa acuminata 35.48 2.00e-22 100.00
IUUC-Mpu-066621 Mustela putorius furo 98.72 0.00e+00 736.00
IUUC-Mlu-067336 Myotis lucifugus 96.68 0.00e+00 704.00
IUUC-Nfi-068530 Neosartorya fischeri 37.98 2.00e-23 103.00
IUUC-Ncr-068785 Neurospora crassa 34.56 1.00e-23 104.00
IUUC-Nle-069972 Nomascus leucogenys 97.44 0.00e+00 697.00
IUUC-Opr-071150 Ochotona princeps 67.77 1.00e-122 432.00
IUUC-Ont-071366 Oreochromis niloticus 81.54 0.00e+00 640.00
IUUC-Oan-073290 Ornithorhynchus anatinus 92.17 3.00e-103 367.00
IUUC-Ocu-074351 Oryctolagus cuniculus 98.21 0.00e+00 732.00
IUUC-Oba-075338 Oryza barthii 37.14 2.00e-11 62.40
IUUC-Obr-076135 Oryza brachyantha 26.43 9.00e-29 120.00
IUUC-Ogl-077182 Oryza glaberrima 36.84 5.00e-17 82.00
IUUC-Ogu-078281 Oryza glumaepatula 27.81 1.00e-27 117.00
IUUC-Oin-079068 Oryza indica 36.28 1.00e-16 81.30
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.80
IUUC-Ome-081781 Oryza meridionalis 27.05 6.00e-25 108.00
IUUC-Oni-082517 Oryza nivara 26.76 1.00e-23 103.00
IUUC-Opu-084101 Oryza punctata 36.84 4.00e-17 82.00
IUUC-Oru-084556 Oryza rufipogon 36.84 5.00e-17 82.00
IUUC-Osa-086264 Oryza sativa 36.28 5.00e-17 82.00
IUUC-Ola-087252 Oryzias latipes 92.62 4.00e-69 253.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.17 3.00e-13 69.30
IUUC-Oga-088304 Otolemur garnettii 96.93 0.00e+00 721.00
IUUC-Oar-089734 Ovis aries 96.93 0.00e+00 717.00
IUUC-Ptr-091476 Pan troglodytes 97.44 0.00e+00 697.00
IUUC-Pan-092341 Papio anubis 97.44 0.00e+00 697.00
IUUC-Psi-093470 Pelodiscus sinensis 91.43 0.00e+00 665.00
IUUC-Pma-094143 Petromyzon marinus 64.36 1.00e-134 472.00
IUUC-Pno-095069 Phaeosphaeria nodorum 30.25 1.00e-13 71.20
IUUC-Ppa-095933 Physcomitrella patens 29.40 6.00e-36 144.00
IUUC-Pfo-096321 Poecilia formosa 79.74 5.00e-176 610.00
IUUC-Pab-098527 Pongo abelii 96.60 3.00e-178 617.00
IUUC-Pop-099323 Populus trichocarpa 27.35 2.00e-36 146.00
IUUC-Pca-101044 Procavia capensis 78.77 1.00e-157 548.00
IUUC-Ppe-101458 Prunus persica 40.83 1.00e-26 113.00
IUUC-Pva-103014 Pteropus vampyrus 87.47 2.00e-173 601.00
IUUC-Pgr-103615 Puccinia graminis 35.34 1.00e-19 91.70
IUUC-Ptt-103826 Puccinia triticina 39.22 7.00e-16 78.60
IUUC-Pte-104171 Pyrenophora teres 33.82 1.00e-20 94.70
IUUC-Pyt-104433 Pyrenophora triticirepentis 31.45 3.00e-10 60.10
IUUC-Rno-105957 Rattus norvegicus 93.35 0.00e+00 694.00
IUUC-Sce-106262 Saccharomyces cerevisiae 26.12 3.00e-10 59.30
IUUC-Sha-107607 Sarcophilus harrisii 93.41 7.00e-173 599.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.50e-02 34.30
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.29 1.00e-25 110.00
IUUC-Smo-108973 Selaginella moellendorffii 39.47 7.00e-21 94.70
IUUC-Sly-111373 Solanum lycopersicum 35.71 5.00e-23 102.00
IUUC-Stu-112844 Solanum tuberosum 35.71 1.00e-22 100.00
IUUC-Sar-113653 Sorex araneus 84.58 3.00e-175 607.00
IUUC-Sbi-114390 Sorghum bicolor 35.54 5.00e-20 92.00
IUUC-Sre-115200 Sporisorium reilianum 36.18 2.00e-23 103.00
IUUC-Ssc-115888 Sus scrofa 98.24 4.00e-112 396.00
IUUC-Tgu-117506 Taeniopygia guttata 83.17 0.00e+00 678.00
IUUC-Tru-118063 Takifugu rubripes 78.77 5.00e-172 597.00
IUUC-Tsy-118851 Tarsius syrichta 73.85 6.00e-144 503.00
IUUC-Tni-120010 Tetraodon nigroviridis 79.08 5.00e-171 593.00
IUUC-Tca-121182 Theobroma cacao 38.10 8.00e-22 97.80
IUUC-Tre-122040 Trichoderma reesei 34.62 6.00e-21 95.50
IUUC-Tvi-122660 Trichoderma virens 38.24 5.00e-25 108.00
IUUC-Tae-124561 Triticum aestivum 37.19 2.00e-20 93.60
IUUC-Tur-126651 Triticum urartu 38.26 3.00e-20 92.00
IUUC-Tme-127184 Tuber melanosporum 45.54 6.00e-25 108.00
IUUC-Tbe-127894 Tupaia belangeri 82.00 2.00e-89 322.00
IUUC-Ttr-128264 Tursiops truncatus 89.00 0.00e+00 704.00
IUUC-Uma-129407 Ustilago maydis 34.87 9.00e-24 105.00
IUUC-Vda-130002 Verticillium dahliae 29.05 2.00e-15 77.40
IUUC-Vpa-130156 Vicugna pacos 96.00 6.00e-97 347.00
IUUC-Vvi-131062 Vitis vinifera 29.13 2.00e-31 129.00
IUUC-Xtr-132332 Xenopus tropicalis 81.68 1.00e-63 234.00
IUUC-Xma-133186 Xiphophorus maculatus 78.50 1.00e-176 612.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 1.00e-12 67.00
IUUC-Zma-135391 Zea mays 36.13 1.00e-19 90.90
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved