• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • BioGRID
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mlu-067336
Ensembl Protein ID ENSMLUP00000014905.2
UniProt Accession G1PUF2; G1PUF2_MYOLU
Genbank Protein ID ENSMLUP00000014905
Protein Name Uncharacterized protein
Genbank Nucleotide ID AAPE02027353
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMLUG00000016353.2 ENSMLUT00000016356.2 ENSMLUP00000014905.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 1.60e-66 222.6 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk++skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGt+pv +rg+tynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMVSKYKYRDLTVRETINVITLYKDLKPVLDSYVFNDGSSRELMNLTGTVPVLYRGNTYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Myotis lucifugus
Protein Sequence
(Fasta)
MAVSESQLKK MVSKYKYRDL TVRETINVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTVP 60
VLYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mlu-067336|UBD,UBD_UEV|Myotis lucifugus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GTGGCCGCCA TGGCCGTGTC GGAGAGCCAG CTCAAGAAGA TGGTGTCCAA GGTGAGGCCG 60
CGACGCGCTC GCCCCGGCGC GCGCCCACCG CCGCCTTCCG TGCCCGGGCC GGCATGGCCC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mlu-067336|UBD,UBD_UEV|Myotis lucifugus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 40.00 4.00e-21 95.50
IUUC-Aml-002415 Ailuropoda melanoleuca 96.93 0.00e+00 733.00
IUUC-Atr-002875 Amborella trichopoda 28.85 9.00e-37 147.00
IUUC-Apl-003473 Anas platyrhynchos 88.27 0.00e+00 681.00
IUUC-Aca-004573 Anolis carolinensis 90.56 0.00e+00 677.00
IUUC-Aly-006164 Arabidopsis lyrata 42.16 7.00e-21 94.70
IUUC-Ath-006575 Arabidopsis thaliana 42.16 7.00e-21 94.70
IUUC-Ago-007755 Ashbya gossypii 25.00 1.00e-05 44.30
IUUC-Acl-008218 Aspergillus clavatus 38.76 3.00e-25 110.00
IUUC-Afl-008597 Aspergillus flavus 39.85 2.00e-25 110.00
IUUC-Afu-009017 Aspergillus fumigatus 37.21 7.00e-23 102.00
IUUC-Ani-009468 Aspergillus nidulans 38.64 5.00e-21 95.90
IUUC-Ang-009755 Aspergillus niger 36.51 2.00e-22 100.00
IUUC-Aor-010072 Aspergillus oryzae 38.35 1.00e-25 111.00
IUUC-Ate-010400 Aspergillus terreus 38.76 1.00e-24 108.00
IUUC-Ame-011620 Astyanax mexicanus 80.77 0.00e+00 645.00
IUUC-Bgr-012136 Blumeria graminis 35.77 4.00e-24 105.00
IUUC-Bta-012557 Bos taurus 97.19 0.00e+00 724.00
IUUC-Bci-013881 Botrytis cinerea 37.41 5.00e-26 112.00
IUUC-Bdi-014325 Brachypodium distachyon 32.11 3.00e-15 75.90
IUUC-Bol-016308 Brassica oleracea 40.00 2.00e-25 110.00
IUUC-Bra-017605 Brassica rapa 39.52 1.00e-25 110.00
IUUC-Cel-018697 Caenorhabditis elegans 48.84 1.00e-37 150.00
IUUC-Cja-018963 Callithrix jacchus 90.56 0.00e+00 715.00
IUUC-Cfa-020472 Canis familiaris 96.93 0.00e+00 730.00
IUUC-Cpo-022001 Cavia porcellus 98.72 0.00e+00 739.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 30.05 2.00e-31 130.00
IUUC-Csa-023959 Chlorocebus sabaeus 97.95 0.00e+00 704.00
IUUC-Cho-024389 Choloepus hoffmanni 55.45 1.00e-38 154.00
IUUC-Cin-025688 Ciona intestinalis 44.53 1.00e-99 356.00
IUUC-Cne-026904 Cryptococcus neoformans 29.09 1.00e-14 74.70
IUUC-Cme-027280 Cyanidioschyzon merolae 40.00 1.00e-18 87.00
IUUC-Dre-027913 Danio rerio 81.03 3.00e-177 614.00
IUUC-Dno-029672 Dasypus novemcinctus 96.93 0.00e+00 743.00
IUUC-Dor-030175 Dipodomys ordii 97.00 5.00e-94 337.00
IUUC-Dse-031375 Dothistroma septosporum 32.85 7.00e-23 102.00
IUUC-Dme-031736 Drosophila melanogaster 48.79 5.00e-97 347.00
IUUC-Ete-032343 Echinops telfairi 92.33 0.00e+00 699.00
IUUC-Eca-033926 Equus caballus 97.19 0.00e+00 727.00
IUUC-Eeu-034940 Erinaceus europaeus 89.51 0.00e+00 715.00
IUUC-Fca-035491 Felis catus 96.68 0.00e+00 714.00
IUUC-Fal-037508 Ficedula albicollis 90.56 0.00e+00 677.00
IUUC-Fox-037937 Fusarium oxysporum 32.31 4.00e-21 96.30
IUUC-Fso-038091 Fusarium solani 36.03 7.00e-25 108.00
IUUC-Gmo-039427 Gadus morhua 78.66 1.00e-172 598.00
IUUC-Ggr-039724 Gaeumannomyces graminis 36.57 3.00e-25 110.00
IUUC-Gga-040998 Gallus gallus 88.24 0.00e+00 699.00
IUUC-Gac-041356 Gasterosteus aculeatus 80.72 0.00e+00 642.00
IUUC-Gma-043566 Glycine max 38.10 5.00e-25 108.00
IUUC-Ggo-044967 Gorilla gorilla 97.95 0.00e+00 704.00
IUUC-Hsa-046686 Homo sapiens 97.95 0.00e+00 704.00
IUUC-Hvu-047430 Hordeum vulgare 40.00 3.00e-21 95.90
IUUC-Itr-047929 Ictidomys tridecemlineatus 98.21 2.00e-110 391.00
IUUC-Kpa-049287 Komagataella pastoris 30.25 2.00e-15 77.00
IUUC-Lch-050597 Latimeria chalumnae 86.99 0.00e+00 678.00
IUUC-Lpe-051090 Leersia perrieri 38.26 2.00e-20 93.20
IUUC-Loc-052399 Lepisosteus oculatus 81.12 2.00e-178 617.00
IUUC-Lma-053249 Leptosphaeria maculans 30.70 9.00e-14 72.00
IUUC-Laf-053766 Loxodonta africana 98.47 0.00e+00 737.00
IUUC-Mcc-055641 Macaca mulatta 97.95 0.00e+00 704.00
IUUC-Meu-055919 Macropus eugenii 90.80 5.00e-172 596.00
IUUC-Mor-056970 Magnaporthe oryzae 37.69 2.00e-24 107.00
IUUC-Mpo-057345 Magnaporthe poae 36.15 4.00e-23 102.00
IUUC-Mtr-058436 Medicago truncatula 29.16 4.00e-35 142.00
IUUC-Mla-059037 Melampsora laricipopulina 35.17 1.00e-25 111.00
IUUC-Mga-059263 Meleagris gallopavo 87.53 0.00e+00 672.00
IUUC-Mvi-060463 Microbotryum violaceum 28.30 2.00e-16 80.50
IUUC-Mmr-060915 Microcebus murinus 97.70 0.00e+00 731.00
IUUC-Mdo-062449 Monodelphis domestica 94.12 0.00e+00 694.00
IUUC-Mmu-063151 Mus musculus 94.63 0.00e+00 709.00
IUUC-Mac-065581 Musa acuminata 35.66 3.00e-22 99.40
IUUC-Mpu-066621 Mustela putorius furo 96.93 0.00e+00 733.00
IUUC-Nfi-068530 Neosartorya fischeri 37.98 6.00e-23 102.00
IUUC-Ncr-068785 Neurospora crassa 36.03 5.00e-25 109.00
IUUC-Nle-069972 Nomascus leucogenys 97.95 0.00e+00 704.00
IUUC-Opr-071150 Ochotona princeps 68.29 1.00e-123 436.00
IUUC-Ont-071366 Oreochromis niloticus 81.79 0.00e+00 641.00
IUUC-Oan-073290 Ornithorhynchus anatinus 93.48 1.00e-105 375.00
IUUC-Ocu-074351 Oryctolagus cuniculus 97.95 0.00e+00 734.00
IUUC-Oba-075338 Oryza barthii 37.50 3.00e-11 62.40
IUUC-Obr-076135 Oryza brachyantha 26.32 1.00e-28 120.00
IUUC-Ogl-077182 Oryza glaberrima 37.04 5.00e-17 82.00
IUUC-Ogu-078281 Oryza glumaepatula 37.39 4.00e-20 92.40
IUUC-Oin-079068 Oryza indica 36.45 1.00e-16 81.30
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.80
IUUC-Ome-081781 Oryza meridionalis 25.41 8.00e-18 85.10
IUUC-Oni-082517 Oryza nivara 26.92 4.00e-21 95.90
IUUC-Opu-084101 Oryza punctata 37.04 4.00e-17 82.40
IUUC-Oru-084556 Oryza rufipogon 37.04 5.00e-17 82.00
IUUC-Osa-086264 Oryza sativa 37.04 5.00e-17 82.00
IUUC-Ola-087252 Oryzias latipes 93.29 3.00e-69 253.00
IUUC-Olu-087610 Ostreococcus lucimarinus 26.70 2.00e-13 70.10
IUUC-Oga-088304 Otolemur garnettii 97.19 0.00e+00 729.00
IUUC-Oar-089734 Ovis aries 97.19 0.00e+00 724.00
IUUC-Ptr-091476 Pan troglodytes 97.95 0.00e+00 704.00
IUUC-Pan-092341 Papio anubis 97.95 0.00e+00 704.00
IUUC-Psi-093470 Pelodiscus sinensis 92.73 0.00e+00 674.00
IUUC-Pma-094143 Petromyzon marinus 63.54 3.00e-132 464.00
IUUC-Pno-095069 Phaeosphaeria nodorum 31.93 1.00e-14 74.30
IUUC-Ppa-095933 Physcomitrella patens 28.42 2.00e-36 146.00
IUUC-Pfo-096321 Poecilia formosa 79.74 3.00e-176 610.00
IUUC-Pab-098527 Pongo abelii 97.73 1.00e-180 625.00
IUUC-Pop-099323 Populus trichocarpa 28.21 4.00e-37 149.00
IUUC-Pca-101044 Procavia capensis 79.54 3.00e-159 554.00
IUUC-Ppe-101458 Prunus persica 41.67 5.00e-27 115.00
IUUC-Pva-103014 Pteropus vampyrus 87.98 5.00e-175 606.00
IUUC-Pgr-103615 Puccinia graminis 35.34 3.00e-20 93.60
IUUC-Ptt-103826 Puccinia triticina 39.22 2.00e-16 80.50
IUUC-Pte-104171 Pyrenophora teres 35.29 1.00e-21 97.80
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.50
IUUC-Rno-105957 Rattus norvegicus 93.61 0.00e+00 702.00
IUUC-Sce-106262 Saccharomyces cerevisiae 25.37 4.00e-10 59.30
IUUC-Sha-107607 Sarcophilus harrisii 94.84 4.00e-175 607.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.20e-02 34.70
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.29 4.00e-25 109.00
IUUC-Smo-108973 Selaginella moellendorffii 37.72 6.00e-21 95.10
IUUC-Sly-111373 Solanum lycopersicum 37.30 2.00e-24 106.00
IUUC-Stu-112844 Solanum tuberosum 36.51 1.00e-23 103.00
IUUC-Sar-113653 Sorex araneus 84.32 6.00e-176 609.00
IUUC-Sbi-114390 Sorghum bicolor 33.88 5.00e-20 92.00
IUUC-Sre-115200 Sporisorium reilianum 36.84 5.00e-24 105.00
IUUC-Ssc-115888 Sus scrofa 98.24 5.00e-113 399.00
IUUC-Tgu-117506 Taeniopygia guttata 84.15 0.00e+00 685.00
IUUC-Tru-118063 Takifugu rubripes 79.03 4.00e-172 597.00
IUUC-Tsy-118851 Tarsius syrichta 73.85 4.00e-144 504.00
IUUC-Tni-120010 Tetraodon nigroviridis 78.83 2.00e-170 591.00
IUUC-Tca-121182 Theobroma cacao 37.30 4.00e-21 95.90
IUUC-Tre-122040 Trichoderma reesei 36.15 1.00e-22 100.00
IUUC-Tvi-122660 Trichoderma virens 39.71 1.00e-26 114.00
IUUC-Tae-124561 Triticum aestivum 40.00 4.00e-21 95.50
IUUC-Tur-126651 Triticum urartu 40.00 6.00e-21 94.70
IUUC-Tme-127184 Tuber melanosporum 47.32 1.00e-26 114.00
IUUC-Tbe-127894 Tupaia belangeri 82.50 4.00e-90 324.00
IUUC-Ttr-128264 Tursiops truncatus 88.24 0.00e+00 702.00
IUUC-Uma-129407 Ustilago maydis 35.53 1.00e-24 108.00
IUUC-Vda-130002 Verticillium dahliae 29.73 3.00e-16 80.10
IUUC-Vpa-130156 Vicugna pacos 96.00 3.00e-98 351.00
IUUC-Vvi-131062 Vitis vinifera 29.30 4.00e-31 128.00
IUUC-Xtr-132332 Xenopus tropicalis 80.15 7.00e-63 232.00
IUUC-Xma-133186 Xiphophorus maculatus 77.28 2.00e-176 611.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 1.00e-12 67.40
IUUC-Zma-135391 Zea mays 34.45 1.00e-19 90.90
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved