• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
  • PTM
    • CPLM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Pte-104378
Ensembl Protein ID EFQ93090
UniProt Accession E3RMC8; E3RMC8_PYRTT
Genbank Protein ID EFQ93090.1
Protein Name Putative uncharacterized protein
Genbank Nucleotide ID GL533994
Gene Name PTT_09600
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
PTT_09600 EFQ93090 EFQ93090
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.80e-52 176.0 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++dpp+g+sa+p + ++++w+++i+Gp+dtp+e+g+F+l ++f+e YP kPP+vkf++++fhPnvy +G++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLMRDFKRMQTDPPAGVSASPIAD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEAYPNKPPSVKFISQMFHPNVYGTGELCLDILQ--NRWSPTYDVAAI 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvre 139
    l+siqsll++pn++sp+n+ea++l+k+nr+ey k+vre
   Q: 106 LTSIQSLLNDPNTSSPANVEASNLYKENRKEYTKRVRE 143
    ***********************************985 PP
   

Organism Pyrenophora teres
Protein Sequence
(Fasta)
MSTAARRRLM RDFKRMQTDP PAGVSASPIA DNVMTWNAVI IGPADTPFED GTFRLVMHFE 60
EAYPNKPPSV KFISQMFHPN VYGTGELCLD ILQNRWSPTY DVAAILTSIQ SLLNDPNTSS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pte-104378|E2,E2/UBC|Pyrenophora teres
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCTACAG CAGCCCGCCG CCGTTTGATG CGTGACTTCA AGGTATGTTC AGCCAGTTGG 60
TAACTGCAGC AAGCTCGCTG GAGCCCATGG CAGGCAGACT TGAAAGAGGC TTCAGCTGAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pte-104378|E2,E2/UBC|Pyrenophora teres
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG pte:PTT_09600
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 65.10 8.00e-61 223.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.54 4.00e-65 238.00
IUUC-Atr-002862 Amborella trichopoda 66.67 3.00e-62 228.00
IUUC-Apl-004063 Anas platyrhynchos 62.16 1.00e-54 203.00
IUUC-Aca-005001 Anolis carolinensis 68.87 5.00e-65 237.00
IUUC-Aly-005584 Arabidopsis lyrata 66.44 1.00e-61 226.00
IUUC-Ath-007149 Arabidopsis thaliana 66.44 1.00e-61 226.00
IUUC-Ago-007745 Ashbya gossypii 75.33 1.00e-69 253.00
IUUC-Acl-008139 Aspergillus clavatus 96.03 4.00e-86 308.00
IUUC-Afl-008551 Aspergillus flavus 95.36 1.00e-85 306.00
IUUC-Afu-008980 Aspergillus fumigatus 95.36 1.00e-85 306.00
IUUC-Ang-009554 Aspergillus niger 95.36 1.00e-85 306.00
IUUC-Aor-010242 Aspergillus oryzae 95.36 1.00e-85 306.00
IUUC-Ate-010390 Aspergillus terreus 95.36 1.00e-85 306.00
IUUC-Ame-010743 Astyanax mexicanus 70.20 7.00e-65 237.00
IUUC-Bgr-012039 Blumeria graminis 91.18 2.00e-74 268.00
IUUC-Bta-012840 Bos taurus 69.54 4.00e-65 238.00
IUUC-Bci-013919 Botrytis cinerea 92.72 2.00e-83 299.00
IUUC-Bdi-015010 Brachypodium distachyon 67.11 9.00e-62 226.00
IUUC-Bol-016245 Brassica oleracea 66.44 8.00e-62 227.00
IUUC-Bra-018026 Brassica rapa 66.44 8.00e-62 227.00
IUUC-Cel-018244 Caenorhabditis elegans 70.47 2.00e-65 239.00
IUUC-Cja-019737 Callithrix jacchus 69.54 4.00e-65 238.00
IUUC-Cfa-020244 Canis familiaris 69.54 4.00e-65 238.00
IUUC-Cpo-022192 Cavia porcellus 69.54 4.00e-65 238.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.44 1.00e-51 193.00
IUUC-Csa-023430 Chlorocebus sabaeus 69.54 4.00e-65 238.00
IUUC-Cho-024773 Choloepus hoffmanni 54.97 2.00e-45 172.00
IUUC-Cin-025537 Ciona intestinalis 68.46 3.00e-53 199.00
IUUC-Csv-025846 Ciona savignyi 68.00 6.00e-57 211.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 93.38 5.00e-84 300.00
IUUC-Cne-026864 Cryptococcus neoformans 72.48 2.00e-66 242.00
IUUC-Cme-027284 Cyanidioschyzon merolae 64.00 5.00e-51 192.00
IUUC-Dre-027775 Danio rerio 69.54 6.00e-65 237.00
IUUC-Dno-029661 Dasypus novemcinctus 69.54 4.00e-65 238.00
IUUC-Dor-030452 Dipodomys ordii 66.91 1.00e-56 209.00
IUUC-Dse-031487 Dothistroma septosporum 96.69 2.00e-86 309.00
IUUC-Dme-031863 Drosophila melanogaster 70.86 1.00e-64 236.00
IUUC-Ete-032595 Echinops telfairi 67.55 2.00e-63 232.00
IUUC-Eca-033377 Equus caballus 69.54 4.00e-65 238.00
IUUC-Eeu-035191 Erinaceus europaeus 55.56 1.00e-44 170.00
IUUC-Fca-036336 Felis catus 69.54 4.00e-65 238.00
IUUC-Fal-037474 Ficedula albicollis 68.64 2.00e-49 185.00
IUUC-Fox-037808 Fusarium oxysporum 93.38 8.00e-84 300.00
IUUC-Fso-038232 Fusarium solani 92.72 2.00e-83 298.00
IUUC-Gmo-038517 Gadus morhua 69.54 1.00e-64 236.00
IUUC-Ggr-039875 Gaeumannomyces graminis 94.00 1.00e-83 299.00
IUUC-Gga-040494 Gallus gallus 69.54 4.00e-65 238.00
IUUC-Gac-042471 Gasterosteus aculeatus 69.54 4.00e-65 238.00
IUUC-Gma-044057 Glycine max 67.11 2.00e-62 229.00
IUUC-Ggo-044896 Gorilla gorilla 69.54 1.00e-64 236.00
IUUC-Hsa-046239 Homo sapiens 69.54 4.00e-65 238.00
IUUC-Hvu-047054 Hordeum vulgare 65.10 8.00e-61 223.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 69.54 4.00e-65 238.00
IUUC-Kpa-049225 Komagataella pastoris 81.21 2.00e-73 266.00
IUUC-Lch-050283 Latimeria chalumnae 68.87 8.00e-65 237.00
IUUC-Lpe-051301 Leersia perrieri 67.11 5.00e-62 228.00
IUUC-Loc-051962 Lepisosteus oculatus 70.86 9.00e-66 240.00
IUUC-Laf-053380 Loxodonta africana 69.54 4.00e-65 238.00
IUUC-Mcc-054819 Macaca mulatta 69.54 3.00e-65 238.00
IUUC-Meu-056231 Macropus eugenii 69.54 1.00e-64 236.00
IUUC-Mor-057087 Magnaporthe oryzae 93.33 2.00e-74 268.00
IUUC-Mpo-057498 Magnaporthe poae 94.00 8.00e-84 301.00
IUUC-Mtr-058612 Medicago truncatula 67.11 8.00e-54 200.00
IUUC-Mla-058876 Melampsora laricipopulina 74.17 4.00e-63 231.00
IUUC-Mga-059863 Meleagris gallopavo 67.15 3.00e-57 211.00
IUUC-Mvi-060330 Microbotryum violaceum 76.16 5.00e-63 231.00
IUUC-Mmr-060630 Microcebus murinus 69.54 4.00e-65 238.00
IUUC-Mdo-062676 Monodelphis domestica 69.54 4.00e-65 238.00
IUUC-Mmu-063491 Mus musculus 69.54 4.00e-65 238.00
IUUC-Mac-064774 Musa acuminata 67.11 5.00e-62 228.00
IUUC-Mpu-065803 Mustela putorius furo 69.54 4.00e-65 238.00
IUUC-Mlu-067147 Myotis lucifugus 69.54 4.00e-65 238.00
IUUC-Nfi-068580 Neosartorya fischeri 95.36 1.00e-85 306.00
IUUC-Ncr-068913 Neurospora crassa 93.38 7.00e-84 300.00
IUUC-Nle-070105 Nomascus leucogenys 69.54 4.00e-65 238.00
IUUC-Opr-070935 Ochotona princeps 69.54 4.00e-65 238.00
IUUC-Ont-071335 Oreochromis niloticus 69.54 5.00e-65 238.00
IUUC-Oan-072706 Ornithorhynchus anatinus 64.38 5.00e-58 214.00
IUUC-Ocu-074130 Oryctolagus cuniculus 69.54 4.00e-65 238.00
IUUC-Oba-075896 Oryza barthii 67.11 9.00e-62 226.00
IUUC-Obr-076770 Oryza brachyantha 67.79 4.00e-62 228.00
IUUC-Ogl-077116 Oryza glaberrima 67.11 5.00e-62 228.00
IUUC-Ogu-078696 Oryza glumaepatula 67.11 5.00e-62 228.00
IUUC-Oin-079099 Oryza indica 67.11 5.00e-62 228.00
IUUC-Olo-081018 Oryza longistaminata 56.36 4.00e-52 195.00
IUUC-Ome-081285 Oryza meridionalis 67.11 5.00e-62 228.00
IUUC-Oni-082088 Oryza nivara 67.11 5.00e-62 228.00
IUUC-Opu-083310 Oryza punctata 67.11 5.00e-62 228.00
IUUC-Oru-084449 Oryza rufipogon 67.11 5.00e-62 228.00
IUUC-Osa-085923 Oryza sativa 67.11 5.00e-62 228.00
IUUC-Ola-087160 Oryzias latipes 69.54 5.00e-65 238.00
IUUC-Olu-087830 Ostreococcus lucimarinus 67.11 4.00e-54 201.00
IUUC-Oga-088836 Otolemur garnettii 69.54 4.00e-65 238.00
IUUC-Oar-090141 Ovis aries 69.54 4.00e-65 238.00
IUUC-Ptr-091453 Pan troglodytes 69.54 4.00e-65 238.00
IUUC-Pan-092511 Papio anubis 69.54 4.00e-65 238.00
IUUC-Psi-093968 Pelodiscus sinensis 68.87 5.00e-65 237.00
IUUC-Pma-094376 Petromyzon marinus 69.54 3.00e-64 235.00
IUUC-Pno-094935 Phaeosphaeria nodorum 98.68 6.00e-88 313.00
IUUC-Ppa-095689 Physcomitrella patens 67.79 1.00e-52 196.00
IUUC-Pfo-096656 Poecilia formosa 68.87 2.00e-64 236.00
IUUC-Pab-098121 Pongo abelii 69.54 4.00e-65 238.00
IUUC-Pop-099734 Populus trichocarpa 67.11 4.00e-56 208.00
IUUC-Pca-100906 Procavia capensis 64.24 8.00e-58 214.00
IUUC-Ppe-101594 Prunus persica 67.11 3.00e-62 228.00
IUUC-Pva-102380 Pteropus vampyrus 68.87 2.00e-62 229.00
IUUC-Pgr-103611 Puccinia graminis 74.17 2.00e-63 232.00
IUUC-Ptt-103971 Puccinia triticina 77.12 1.00e-48 183.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 100.00 8.00e-89 317.00
IUUC-Rno-105772 Rattus norvegicus 69.54 3.00e-65 238.00
IUUC-Sce-106283 Saccharomyces cerevisiae 75.33 1.00e-69 253.00
IUUC-Sha-107650 Sarcophilus harrisii 68.87 9.00e-64 233.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 81.33 2.00e-66 242.00
IUUC-Spo-108073 Schizosaccharomyces pombe 81.33 2.00e-66 242.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 92.72 2.00e-83 299.00
IUUC-Smo-109512 Selaginella moellendorffii 67.79 3.00e-62 228.00
IUUC-Sit-110731 Setaria italica 67.11 5.00e-62 228.00
IUUC-Sly-111506 Solanum lycopersicum 67.11 2.00e-62 229.00
IUUC-Stu-112080 Solanum tuberosum 67.11 2.00e-62 229.00
IUUC-Sar-113429 Sorex araneus 69.54 4.00e-65 238.00
IUUC-Sbi-114289 Sorghum bicolor 67.11 5.00e-62 228.00
IUUC-Sre-115106 Sporisorium reilianum 74.17 5.00e-63 231.00
IUUC-Ssc-116265 Sus scrofa 69.54 1.00e-64 236.00
IUUC-Tgu-117383 Taeniopygia guttata 69.54 1.00e-64 236.00
IUUC-Tru-118576 Takifugu rubripes 68.87 3.00e-64 234.00
IUUC-Tsy-119000 Tarsius syrichta 69.54 4.00e-65 238.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.87 2.00e-64 235.00
IUUC-Tca-121827 Theobroma cacao 67.79 2.00e-62 229.00
IUUC-Tre-122002 Trichoderma reesei 93.38 1.00e-83 299.00
IUUC-Tvi-122331 Trichoderma virens 93.38 1.00e-83 299.00
IUUC-Tae-124461 Triticum aestivum 66.44 1.00e-61 227.00
IUUC-Tur-126866 Triticum urartu 65.77 3.00e-61 225.00
IUUC-Tme-127148 Tuber melanosporum 93.33 2.00e-83 299.00
IUUC-Tbe-127921 Tupaia belangeri 67.55 1.00e-60 223.00
IUUC-Ttr-129121 Tursiops truncatus 69.54 4.00e-65 238.00
IUUC-Uma-129561 Ustilago maydis 74.17 3.00e-63 232.00
IUUC-Vda-129711 Verticillium dahliae 93.38 5.00e-84 300.00
IUUC-Vpa-130570 Vicugna pacos 61.76 7.00e-51 190.00
IUUC-Vvi-131108 Vitis vinifera 67.11 2.00e-62 229.00
IUUC-Xtr-131824 Xenopus tropicalis 69.54 3.00e-65 238.00
IUUC-Xma-133667 Xiphophorus maculatus 69.54 5.00e-65 238.00
IUUC-Yli-134660 Yarrowia lipolytica 83.44 7.00e-77 277.00
IUUC-Zma-135584 Zea mays 65.77 3.00e-61 225.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved