• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • RAID2
  • PPI
    • HINT
  • PTM
    • mUbiSiDa
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Rno-105498
UUCD1 version UUC-RaN-00965
Ensembl Protein ID ENSRNOP00000060962.3
UniProt Accession P61078; P47986; UB2D3_RAT
Genbank Protein ID AAA85102.1; AAA85100.1; BAA87330.1; AAH72696.1
Protein Name Ubiquitin-conjugating enzyme E2 D3; (E3-independent) E2 ubiquitin-conjugating enzyme D3; E2 ubiquitin-conjugating enzyme D3; Phosphoarginine phosphatase; Ubiquitin carrier protein D3; Ubiquitin-conjugating enzyme E2(17)KB 3; Ubiquitin-conjugating enzyme E2-17 kDa 3; Ubiquitin-protein ligase D3
Genbank Nucleotide ID U13177; U13175; AB006852; BC072696
Gene Name Ube2d3
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSRNOG00000013741.7 ENSRNOT00000066204.3 ENSRNOP00000060962.3
ENSRNOG00000013741.7 ENSRNOT00000083181.1 ENSRNOP00000074051.1
ENSRNOG00000013741.7 ENSRNOT00000079694.1 ENSRNOP00000069374.1
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpress
DNA & RNA Element
microRNATRANSFACRAID2
Protein-protein Interaction
IID
Post-translational Modifications (PTMs)
CPLMdbPAFPhosphositePlus
Protein Expression/Proteomics
GPMDB
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 9.70e-56 187.8 5 138
UBD/UBC-like/UBD_UBC 4.60e-85 283.1 5 142
Active Site
Position(s) Description Evidence
85 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkee 89
    R++kel++l++dpp+++sa+pv + d+++w+++i+Gp+d+pY+ggvF l+i+fp+dYPfkPPkv f+t+i+hPn+++nG++Cl+il+
   Q: 5 RINKELSDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-- 90
    89**********************.9************************************************************9.. PP
   S: 90 ekWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkv 137
    ++Wspal++++vllsi+sll++pnp++pl e+a+++k++r +y+++
   Q: 91 SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRIS 138
    ********************************************9876 PP
   


   UBD/UBC-like/UBD_UBC

   S: 1    rikkelkdllrdeeaqisadlvdddlfelratiagppdspyeggvffltiklptdypfkppkvafitkiyhpninsngsicldilrsqw 89
    ri+kel+dl+rd++aq+sa++v+dd+f+++ati+gp+dspy+ggvfflti++ptdypfkppkvaf+t+iyhpninsngsicldilrsqw
   Q: 5 RINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQW 93
    8**************************************************************************************** PP
   S: 90 saaltlskvllslcslladaepddplvaeiariyktdkekykriarewt 138
    s+alt+skvlls+csll+d++pddplv+eiariyktd++ky+ri+rewt
   Q: 94 SPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWT 142
    ************************************************8 PP
   

Organism Rattus norvegicus
Functional Description
(View)

Functional Description



     Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction.
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction.
Protein Sequence
(Fasta)
MALKRINKEL SDLARDPPAQ CSAGPVGDDM FHWQATIMGP NDSPYQGGVF FLTIHFPTDY 60
PFKPPKVAFT TRIYHPNINS NGSICLDILR SQWSPALTIS KVLLSICSLL CDPNPDDPLV 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Rno-105498|E2,E2/UBC;UBD,UBD_UBC|Rattus norvegicus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTCTGGGCGA AGCGCGGATA TAAGTAGCTG GTGGCTCTGC CACCCCACCC TGCCCGGATC 60
GCGACGGTTT TCAGGGTTCT GGAATCAGCA GGGTTCCTCT GAGGCCTTGG CGAGTGGCTG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Rno-105498|E2,E2/UBC;UBD,UBD_UBC|Rattus norvegicus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0053--Apoptosis
KW-0067--ATP-binding
KW-1003--Cell membrane
KW-0181--Complete proteome
KW-1015--Disulfide bond
KW-0227--DNA damage
KW-0234--DNA repair
KW-0967--Endosome
KW-0472--Membrane
KW-0547--Nucleotide-binding
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0010008--C:endosome membrane
GO:0070062--C:extracellular exosome
GO:0005886--C:plasma membrane
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0004842--F:ubiquitin-protein transferase activity
GO:0006915--P:apoptotic process
GO:0006281--P:DNA repair
GO:1903955--P:positive regulation of protein targeting to mitochondrion
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051865--P:protein autoubiquitination
GO:0070979--P:protein K11-linked ubiquitination
GO:0070936--P:protein K48-linked ubiquitination
GO:0006513--P:protein monoubiquitination
GO:0000209--P:protein polyubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG rno:81920
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000292 Aegilops tauschii 78.91 6.00e-69 252.00
IUUC-Aml-001778 Ailuropoda melanoleuca 97.86 3.00e-80 290.00
IUUC-Atr-002861 Amborella trichopoda 80.27 4.00e-70 256.00
IUUC-Apl-004043 Anas platyrhynchos 94.56 6.00e-82 295.00
IUUC-Aca-005236 Anolis carolinensis 97.28 5.00e-84 302.00
IUUC-Aly-006221 Arabidopsis lyrata 80.95 5.00e-71 259.00
IUUC-Ath-007700 Arabidopsis thaliana 80.95 4.00e-70 256.00
IUUC-Ago-007967 Ashbya gossypii 79.59 1.00e-70 258.00
IUUC-Acl-008266 Aspergillus clavatus 85.03 2.00e-74 270.00
IUUC-Afl-008709 Aspergillus flavus 78.17 2.00e-68 253.00
IUUC-Afu-008956 Aspergillus fumigatus 85.71 1.00e-74 271.00
IUUC-Ani-009401 Aspergillus nidulans 83.67 3.00e-73 266.00
IUUC-Ang-009725 Aspergillus niger 84.00 9.00e-62 228.00
IUUC-Aor-010157 Aspergillus oryzae 85.03 2.00e-74 270.00
IUUC-Ate-010438 Aspergillus terreus 84.35 2.00e-73 267.00
IUUC-Ame-011831 Astyanax mexicanus 95.24 1.00e-82 297.00
IUUC-Bgr-012238 Blumeria graminis 79.59 3.00e-69 253.00
IUUC-Bta-013158 Bos taurus 97.28 5.00e-84 302.00
IUUC-Bci-013661 Botrytis cinerea 83.67 3.00e-74 270.00
IUUC-Bdi-014561 Brachypodium distachyon 79.59 3.00e-70 256.00
IUUC-Bol-015722 Brassica oleracea 81.63 7.00e-71 259.00
IUUC-Bra-017985 Brassica rapa 80.95 6.00e-71 259.00
IUUC-Cel-018362 Caenorhabditis elegans 92.52 1.00e-80 291.00
IUUC-Cja-019886 Callithrix jacchus 97.28 5.00e-84 302.00
IUUC-Cfa-020436 Canis familiaris 97.28 5.00e-84 302.00
IUUC-Cpo-022334 Cavia porcellus 97.96 3.00e-83 300.00
IUUC-Cre-022765 Chlamydomonas reinhardtii 78.23 1.00e-68 251.00
IUUC-Csa-023148 Chlorocebus sabaeus 93.24 3.00e-79 286.00
IUUC-Cin-025379 Ciona intestinalis 86.30 1.00e-76 278.00
IUUC-Cgl-026490 Colletotrichum gloeosporioides 84.35 6.00e-74 268.00
IUUC-Cne-026957 Cryptococcus neoformans 80.14 2.00e-69 254.00
IUUC-Dre-027758 Danio rerio 96.60 2.00e-83 300.00
IUUC-Dno-029156 Dasypus novemcinctus 98.60 3.00e-82 296.00
IUUC-Dor-030285 Dipodomys ordii 100.00 7.00e-81 291.00
IUUC-Dse-031397 Dothistroma septosporum 84.35 3.00e-74 270.00
IUUC-Dme-031594 Drosophila melanogaster 93.88 3.00e-81 293.00
IUUC-Ete-032295 Echinops telfairi 97.84 7.00e-80 288.00
IUUC-Eca-034286 Equus caballus 100.00 7.00e-81 291.00
IUUC-Eeu-034766 Erinaceus europaeus 97.14 1.00e-78 284.00
IUUC-Fca-035917 Felis catus 100.00 1.00e-85 307.00
IUUC-Fal-036904 Ficedula albicollis 100.00 2.00e-81 293.00
IUUC-Fox-038021 Fusarium oxysporum 84.35 7.00e-74 268.00
IUUC-Fso-038297 Fusarium solani 83.67 1.00e-73 268.00
IUUC-Gmo-038898 Gadus morhua 97.90 4.00e-82 296.00
IUUC-Ggr-039912 Gaeumannomyces graminis 79.61 2.00e-69 254.00
IUUC-Gga-041015 Gallus gallus 97.96 1.00e-84 305.00
IUUC-Gac-042231 Gasterosteus aculeatus 94.56 8.00e-82 295.00
IUUC-Gma-043733 Glycine max 80.27 8.00e-71 258.00
IUUC-Ggo-045076 Gorilla gorilla 96.53 9.00e-81 291.00
IUUC-Hsa-046157 Homo sapiens 100.00 1.00e-85 307.00
IUUC-Hvu-047546 Hordeum vulgare 77.55 2.00e-68 251.00
IUUC-Itr-048882 Ictidomys tridecemlineatus 95.27 2.00e-81 293.00
IUUC-Kpa-049290 Komagataella pastoris 78.23 6.00e-69 252.00
IUUC-Lch-050109 Latimeria chalumnae 85.71 4.00e-77 279.00
IUUC-Lpe-050972 Leersia perrieri 79.59 7.00e-70 255.00
IUUC-Loc-052838 Lepisosteus oculatus 91.84 8.00e-81 291.00
IUUC-Lma-053121 Leptosphaeria maculans 84.35 2.00e-74 270.00
IUUC-Laf-053580 Loxodonta africana 97.86 2.00e-80 290.00
IUUC-Mcc-055421 Macaca mulatta 91.84 8.00e-81 291.00
IUUC-Meu-056462 Macropus eugenii 98.56 1.00e-79 288.00
IUUC-Mor-057235 Magnaporthe oryzae 83.67 2.00e-73 266.00
IUUC-Mpo-057596 Magnaporthe poae 79.61 3.00e-69 253.00
IUUC-Mtr-058257 Medicago truncatula 79.59 2.00e-69 254.00
IUUC-Mla-059189 Melampsora laricipopulina 80.95 7.00e-69 252.00
IUUC-Mga-059237 Meleagris gallopavo 100.00 2.00e-81 293.00
IUUC-Mvi-060397 Microbotryum violaceum 82.31 5.00e-72 262.00
IUUC-Mmr-060889 Microcebus murinus 97.96 1.00e-84 305.00
IUUC-Mdo-062596 Monodelphis domestica 99.32 2.00e-85 306.00
IUUC-Mmu-063796 Mus musculus 97.96 1.00e-84 305.00
IUUC-Mac-064668 Musa acuminata 79.59 3.00e-69 254.00
IUUC-Mpu-066604 Mustela putorius furo 93.84 4.00e-81 293.00
IUUC-Nfi-068599 Neosartorya fischeri 85.71 1.00e-74 271.00
IUUC-Ncr-068677 Neurospora crassa 82.99 2.00e-72 264.00
IUUC-Nle-069715 Nomascus leucogenys 91.84 8.00e-81 291.00
IUUC-Opr-070191 Ochotona princeps 100.00 7.00e-81 291.00
IUUC-Ont-071766 Oreochromis niloticus 95.92 5.00e-83 299.00
IUUC-Oan-073026 Ornithorhynchus anatinus 90.78 6.00e-77 279.00
IUUC-Ocu-074315 Oryctolagus cuniculus 97.28 5.00e-84 302.00
IUUC-Oba-075411 Oryza barthii 79.59 1.00e-69 254.00
IUUC-Obr-076658 Oryza brachyantha 79.59 7.00e-70 255.00
IUUC-Ogl-076968 Oryza glaberrima 80.27 2.00e-70 257.00
IUUC-Ogu-078091 Oryza glumaepatula 79.31 4.00e-69 255.00
IUUC-Oin-079659 Oryza indica 80.27 2.00e-70 257.00
IUUC-Olo-080786 Oryza longistaminata 79.59 1.00e-69 254.00
IUUC-Ome-081987 Oryza meridionalis 78.91 4.00e-69 253.00
IUUC-Oni-082391 Oryza nivara 80.27 2.00e-70 259.00
IUUC-Opu-083833 Oryza punctata 79.59 8.00e-70 255.00
IUUC-Oru-085167 Oryza rufipogon 80.27 2.00e-70 259.00
IUUC-Osa-086003 Oryza sativa 80.27 2.00e-70 257.00
IUUC-Ola-086331 Oryzias latipes 95.92 5.00e-83 299.00
IUUC-Olu-087615 Ostreococcus lucimarinus 76.19 2.00e-65 240.00
IUUC-Oga-088477 Otolemur garnettii 95.21 2.00e-82 296.00
IUUC-Oar-090038 Ovis aries 100.00 1.00e-85 307.00
IUUC-Ptr-091438 Pan troglodytes 98.64 1.00e-84 304.00
IUUC-Pan-092143 Papio anubis 97.28 5.00e-84 302.00
IUUC-Psi-094076 Pelodiscus sinensis 100.00 1.00e-85 307.00
IUUC-Pma-094405 Petromyzon marinus 93.33 2.00e-74 270.00
IUUC-Pno-094765 Phaeosphaeria nodorum 84.35 2.00e-74 270.00
IUUC-Ppa-095564 Physcomitrella patens 80.27 2.00e-69 254.00
IUUC-Pfo-096753 Poecilia formosa 95.92 5.00e-83 299.00
IUUC-Pab-098293 Pongo abelii 98.66 3.00e-84 303.00
IUUC-Pop-098830 Populus trichocarpa 80.27 4.00e-70 256.00
IUUC-Ppe-101431 Prunus persica 81.63 6.00e-71 258.00
IUUC-Pgr-103381 Puccinia graminis 82.31 1.00e-69 255.00
IUUC-Ptt-103723 Puccinia triticina 77.14 9.00e-61 225.00
IUUC-Pte-104015 Pyrenophora teres 84.35 2.00e-74 270.00
IUUC-Pyt-104701 Pyrenophora triticirepentis 84.35 2.00e-74 270.00
IUUC-Sce-106463 Saccharomyces cerevisiae 80.56 9.00e-70 255.00
IUUC-Sja-107729 Schizosaccharomyces japonicus 84.35 3.00e-73 266.00
IUUC-Spo-108032 Schizosaccharomyces pombe 84.35 1.00e-73 268.00
IUUC-Ssl-108443 Sclerotinia sclerotiorum 84.35 1.00e-74 271.00
IUUC-Smo-108911 Selaginella moellendorffii 80.27 3.00e-69 253.00
IUUC-Sit-109936 Setaria italica 78.91 4.00e-70 257.00
IUUC-Sly-111055 Solanum lycopersicum 80.95 5.00e-70 256.00
IUUC-Stu-112436 Solanum tuberosum 78.91 2.00e-70 257.00
IUUC-Sar-113302 Sorex araneus 97.84 7.00e-80 288.00
IUUC-Sbi-114840 Sorghum bicolor 80.27 2.00e-70 257.00
IUUC-Sre-115037 Sporisorium reilianum 81.12 1.00e-69 254.00
IUUC-Ssc-116154 Sus scrofa 95.92 1.00e-82 297.00
IUUC-Tgu-116727 Taeniopygia guttata 100.00 1.00e-85 307.00
IUUC-Tru-118272 Takifugu rubripes 95.92 1.00e-82 297.00
IUUC-Tsy-118832 Tarsius syrichta 89.12 8.00e-78 281.00
IUUC-Tni-120056 Tetraodon nigroviridis 95.92 1.00e-82 297.00
IUUC-Tca-121542 Theobroma cacao 78.91 2.00e-70 258.00
IUUC-Tre-122125 Trichoderma reesei 82.31 1.00e-71 261.00
IUUC-Tvi-122296 Trichoderma virens 82.31 1.00e-71 261.00
IUUC-Tae-123340 Triticum aestivum 80.95 2.00e-71 260.00
IUUC-Tur-126518 Triticum urartu 78.91 3.00e-69 254.00
IUUC-Tme-126912 Tuber melanosporum 82.31 4.00e-72 263.00
IUUC-Uma-129648 Ustilago maydis 81.63 2.00e-71 260.00
IUUC-Vda-129695 Verticillium dahliae 84.35 6.00e-74 268.00
IUUC-Vpa-130446 Vicugna pacos 97.14 4.00e-79 287.00
IUUC-Vvi-131016 Vitis vinifera 80.27 1.00e-70 258.00
IUUC-Xtr-132329 Xenopus tropicalis 97.28 5.00e-84 302.00
IUUC-Xma-133829 Xiphophorus maculatus 95.92 5.00e-83 299.00
IUUC-Yli-134353 Yarrowia lipolytica 79.59 3.00e-71 260.00
IUUC-Zma-135956 Zea mays 78.91 4.00e-69 253.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved