• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
iUUCD ID IUUC-Afu-008785
Ensembl Protein ID CADAFUAP00006107
UniProt Accession Q4WTT8; SKP1_ASPFU
Genbank Protein ID EAL91988.1
Protein Name E3 ubiquitin ligase complex SCF subunit sconC; Sulfur controller C; Sulfur metabolite repression control protein C
Genbank Nucleotide ID AAHF01000003
Gene Name AFUA_5G06060; sconC; skpA
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CADAFUAG00006107 CADAFUAT00006107 CADAFUAP00006107
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 6.70e-31 105.2 109 156
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k LLd++cktVa+mikgk+peeiRktFni+nDftpeEe+++R+En+WA
   Q: 109 KALLDVGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWA 156
    78*********************************************9 PP
   

Organism Aspergillus fumigatus
Functional Description
(View)

Functional Description



     Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Protein Sequence
(Fasta)
MTTVTLTSSD GVDITVDRDV AERSILIKNM LEDLGESDEA IPIPNVNEVV LKKVIEWCTH 60
HKNDPPSTGD DDDSRRKTTD IDEWDQKFMQ VDQEMLFEII LAANYLDIKA LLDVGCKTVA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Afu-008785|E3,SKP1|Aspergillus fumigatus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGACTACTG TTACTCTCAC AAGCTCCGAT GGCGTTGACA TTACGGTCGG TAAGTTGTCT 60
CGTCCTTCTA TGCCCTTCGT GTCCGGTCCT TGGAAAATGA ATGCACTCTA TCTTTACTTT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Afu-008785|E3,SKP1|Aspergillus fumigatus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0043295--F:glutathione binding
GO:0016567--P:protein ubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG afm:AFUA_5G06060
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 54.19 1.00e-44 170.00
IUUC-Aml-002023 Ailuropoda melanoleuca 63.58 5.00e-47 178.00
IUUC-Atr-002858 Amborella trichopoda 54.84 8.00e-36 140.00
IUUC-Apl-003393 Anas platyrhynchos 63.58 5.00e-47 178.00
IUUC-Aca-004709 Anolis carolinensis 63.58 5.00e-47 178.00
IUUC-Aly-006236 Arabidopsis lyrata 49.04 4.00e-39 152.00
IUUC-Ath-007456 Arabidopsis thaliana 50.97 4.00e-40 155.00
IUUC-Ago-007847 Ashbya gossypii 54.65 3.00e-49 185.00
IUUC-Acl-008178 Aspergillus clavatus 98.09 1.00e-88 316.00
IUUC-Afl-008452 Aspergillus flavus 92.95 3.00e-83 298.00
IUUC-Ani-009312 Aspergillus nidulans 83.87 2.00e-68 249.00
IUUC-Aor-010012 Aspergillus oryzae 92.95 3.00e-83 298.00
IUUC-Ate-010375 Aspergillus terreus 94.87 1.00e-85 306.00
IUUC-Ame-011025 Astyanax mexicanus 64.20 2.00e-47 179.00
IUUC-Bgr-012280 Blumeria graminis 73.10 9.00e-50 187.00
IUUC-Bta-013519 Bos taurus 63.58 5.00e-47 178.00
IUUC-Bci-013888 Botrytis cinerea 78.69 1.00e-44 170.00
IUUC-Bdi-014547 Brachypodium distachyon 51.61 2.00e-35 139.00
IUUC-Bol-016431 Brassica oleracea 53.85 4.00e-36 142.00
IUUC-Bra-017062 Brassica rapa 52.26 1.00e-24 103.00
IUUC-Cel-018653 Caenorhabditis elegans 68.33 4.00e-47 178.00
IUUC-Cja-019785 Callithrix jacchus 63.40 2.00e-42 162.00
IUUC-Cfa-020931 Canis familiaris 63.58 5.00e-47 178.00
IUUC-Cpo-022487 Cavia porcellus 63.35 1.00e-45 173.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 56.13 2.00e-40 156.00
IUUC-Csa-023459 Chlorocebus sabaeus 62.96 1.00e-46 176.00
IUUC-Cho-024854 Choloepus hoffmanni 57.81 3.00e-14 68.60
IUUC-Cin-025538 Ciona intestinalis 60.87 1.00e-45 173.00
IUUC-Csv-025865 Ciona savignyi 60.25 5.00e-50 188.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 73.10 3.00e-59 218.00
IUUC-Cne-027058 Cryptococcus neoformans 69.38 5.00e-61 224.00
IUUC-Cme-027174 Cyanidioschyzon merolae 44.87 3.00e-35 139.00
IUUC-Dre-027756 Danio rerio 64.20 2.00e-47 179.00
IUUC-Dno-028924 Dasypus novemcinctus 63.58 5.00e-47 178.00
IUUC-Dor-030847 Dipodomys ordii 56.79 7.00e-42 160.00
IUUC-Dse-031209 Dothistroma septosporum 79.62 6.00e-66 241.00
IUUC-Dme-032028 Drosophila melanogaster 55.90 1.00e-48 183.00
IUUC-Ete-033117 Echinops telfairi 61.11 4.00e-44 168.00
IUUC-Eca-033320 Equus caballus 63.58 5.00e-47 178.00
IUUC-Eeu-034817 Erinaceus europaeus 68.18 1.00e-13 65.90
IUUC-Fca-035423 Felis catus 63.58 5.00e-47 178.00
IUUC-Fal-036956 Ficedula albicollis 63.58 5.00e-47 178.00
IUUC-Fox-037761 Fusarium oxysporum 76.55 5.00e-60 221.00
IUUC-Fso-038451 Fusarium solani 74.15 5.00e-60 221.00
IUUC-Gmo-039178 Gadus morhua 64.20 2.00e-47 179.00
IUUC-Ggr-039831 Gaeumannomyces graminis 72.79 8.00e-58 214.00
IUUC-Gga-040238 Gallus gallus 63.58 5.00e-47 178.00
IUUC-Gac-041965 Gasterosteus aculeatus 64.20 2.00e-47 179.00
IUUC-Gma-043086 Glycine max 54.78 4.00e-38 148.00
IUUC-Ggo-045025 Gorilla gorilla 63.58 5.00e-47 178.00
IUUC-Hsa-046875 Homo sapiens 63.58 5.00e-47 178.00
IUUC-Hvu-047497 Hordeum vulgare 53.16 2.00e-39 152.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 62.35 2.00e-46 176.00
IUUC-Kpa-049138 Komagataella pastoris 55.80 6.00e-49 184.00
IUUC-Lch-050522 Latimeria chalumnae 65.16 2.00e-51 192.00
IUUC-Lpe-050890 Leersia perrieri 52.80 2.00e-34 136.00
IUUC-Loc-052596 Lepisosteus oculatus 64.20 2.00e-47 179.00
IUUC-Lma-053020 Leptosphaeria maculans 77.46 9.00e-58 214.00
IUUC-Laf-053847 Loxodonta africana 63.58 5.00e-47 178.00
IUUC-Mor-057176 Magnaporthe oryzae 73.47 2.00e-58 216.00
IUUC-Mpo-057471 Magnaporthe poae 72.79 7.00e-58 214.00
IUUC-Mtr-058458 Medicago truncatula 49.68 1.00e-39 153.00
IUUC-Mla-059153 Melampsora laricipopulina 70.97 4.00e-58 215.00
IUUC-Mga-059864 Meleagris gallopavo 63.58 5.00e-47 178.00
IUUC-Mvi-060342 Microbotryum violaceum 71.79 2.00e-63 232.00
IUUC-Mdo-062509 Monodelphis domestica 63.58 5.00e-47 178.00
IUUC-Mmu-063694 Mus musculus 64.20 2.00e-47 179.00
IUUC-Mac-064537 Musa acuminata 52.73 9.00e-36 140.00
IUUC-Mpu-065990 Mustela putorius furo 63.58 5.00e-47 178.00
IUUC-Mlu-068168 Myotis lucifugus 63.58 5.00e-47 178.00
IUUC-Nfi-068309 Neosartorya fischeri 100.00 2.00e-90 322.00
IUUC-Ncr-068658 Neurospora crassa 75.51 5.00e-62 228.00
IUUC-Nle-070101 Nomascus leucogenys 63.58 5.00e-47 178.00
IUUC-Opr-070881 Ochotona princeps 63.58 5.00e-47 178.00
IUUC-Ont-071529 Oreochromis niloticus 64.20 2.00e-47 179.00
IUUC-Oan-073000 Ornithorhynchus anatinus 82.46 6.00e-25 102.00
IUUC-Ocu-073780 Oryctolagus cuniculus 63.58 5.00e-47 178.00
IUUC-Oba-075110 Oryza barthii 44.44 1.00e-34 137.00
IUUC-Obr-076218 Oryza brachyantha 55.35 2.00e-38 150.00
IUUC-Ogl-077257 Oryza glaberrima 46.15 4.00e-37 145.00
IUUC-Ogu-078927 Oryza glumaepatula 50.00 3.00e-34 135.00
IUUC-Oin-080141 Oryza indica 46.15 4.00e-37 145.00
IUUC-Olo-080834 Oryza longistaminata 40.00 2.00e-32 129.00
IUUC-Ome-081685 Oryza meridionalis 50.00 3.00e-34 135.00
IUUC-Oni-082067 Oryza nivara 45.52 6.00e-34 134.00
IUUC-Opu-083354 Oryza punctata 50.00 1.00e-35 140.00
IUUC-Oru-084769 Oryza rufipogon 44.44 3.00e-35 139.00
IUUC-Osa-085479 Oryza sativa 44.44 3.00e-35 139.00
IUUC-Ola-087270 Oryzias latipes 64.20 2.00e-47 179.00
IUUC-Olu-087667 Ostreococcus lucimarinus 52.90 5.00e-42 161.00
IUUC-Oga-089073 Otolemur garnettii 63.58 5.00e-47 178.00
IUUC-Oar-089391 Ovis aries 61.25 3.00e-42 162.00
IUUC-Ptr-090872 Pan troglodytes 59.63 2.00e-45 172.00
IUUC-Pan-091780 Papio anubis 63.58 5.00e-47 178.00
IUUC-Psi-093135 Pelodiscus sinensis 63.58 5.00e-47 178.00
IUUC-Pno-094810 Phaeosphaeria nodorum 77.46 4.00e-53 198.00
IUUC-Ppa-095244 Physcomitrella patens 56.13 1.00e-39 153.00
IUUC-Pfo-097529 Poecilia formosa 64.20 2.00e-47 179.00
IUUC-Pab-098533 Pongo abelii 63.58 5.00e-47 178.00
IUUC-Pop-098957 Populus trichocarpa 55.62 1.00e-39 153.00
IUUC-Pca-100783 Procavia capensis 54.32 3.00e-36 142.00
IUUC-Ppe-101410 Prunus persica 50.00 5.00e-40 154.00
IUUC-Pva-102901 Pteropus vampyrus 63.58 5.00e-47 178.00
IUUC-Pgr-103499 Puccinia graminis 69.03 2.00e-57 212.00
IUUC-Ptt-103874 Puccinia triticina 75.97 3.00e-55 206.00
IUUC-Pte-104224 Pyrenophora teres 80.99 2.00e-52 196.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 79.02 1.00e-52 196.00
IUUC-Rno-105499 Rattus norvegicus 64.20 2.00e-47 179.00
IUUC-Sce-106387 Saccharomyces cerevisiae 50.53 4.00e-46 175.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 70.81 3.00e-63 231.00
IUUC-Spo-108033 Schizosaccharomyces pombe 69.38 4.00e-61 224.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 79.31 4.00e-63 231.00
IUUC-Smo-109307 Selaginella moellendorffii 56.69 5.00e-40 154.00
IUUC-Sit-110435 Setaria italica 49.69 2.00e-34 136.00
IUUC-Sly-111529 Solanum lycopersicum 54.19 1.00e-36 143.00
IUUC-Stu-112023 Solanum tuberosum 53.55 2.00e-37 145.00
IUUC-Sar-112973 Sorex araneus 58.64 2.00e-39 153.00
IUUC-Sbi-114394 Sorghum bicolor 52.50 6.00e-39 151.00
IUUC-Sre-115178 Sporisorium reilianum 74.36 4.00e-68 248.00
IUUC-Tgu-116474 Taeniopygia guttata 63.58 5.00e-47 178.00
IUUC-Tru-118429 Takifugu rubripes 63.58 2.00e-47 179.00
IUUC-Tsy-118896 Tarsius syrichta 63.58 5.00e-47 178.00
IUUC-Tni-119960 Tetraodon nigroviridis 63.58 2.00e-47 179.00
IUUC-Tca-121022 Theobroma cacao 54.84 7.00e-39 150.00
IUUC-Tre-122004 Trichoderma reesei 72.22 5.00e-51 191.00
IUUC-Tvi-122449 Trichoderma virens 72.22 2.00e-51 192.00
IUUC-Tae-125854 Triticum aestivum 54.19 1.00e-44 170.00
IUUC-Tur-126421 Triticum urartu 54.55 1.00e-40 156.00
IUUC-Tme-127078 Tuber melanosporum 79.75 3.00e-63 231.00
IUUC-Tbe-127720 Tupaia belangeri 63.58 5.00e-47 178.00
IUUC-Ttr-129035 Tursiops truncatus 63.58 5.00e-47 178.00
IUUC-Uma-129517 Ustilago maydis 73.08 8.00e-66 240.00
IUUC-Vda-129691 Verticillium dahliae 73.79 3.00e-53 199.00
IUUC-Vpa-130128 Vicugna pacos 63.58 5.00e-47 177.00
IUUC-Vvi-130876 Vitis vinifera 55.13 3.00e-44 168.00
IUUC-Xtr-132393 Xenopus tropicalis 63.58 5.00e-47 178.00
IUUC-Xma-133603 Xiphophorus maculatus 64.20 2.00e-47 179.00
IUUC-Yli-134499 Yarrowia lipolytica 70.62 6.00e-63 231.00
IUUC-Zma-135354 Zea mays 47.17 8.00e-37 144.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved