• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
UUCD2 ID IUUC-Ogl-077571
UUCD1 version UUC-OrG-01844
Ensembl Protein ID ORGLA01G0026500.1
UniProt Accession I1NK75; I1NK75_ORYGL
Protein Name Uncharacterized protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ORGLA01G0026500 ORGLA01G0026500.1 ORGLA01G0026500.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/N-recognin/UBR-box 1.40e-19 71.0 133 200
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/N-recognin/UBR-box

   S: 2    lCgrvfkvgetiyeCrtCsvdetlvlCteCfakvvHkdHeyklkksggggfCdCGdteAwedgskCkkl 70
    Cg v+ +++ y+CrtC+ d+t+++C+ Cf++ HkdH+y++ +g gg+CdCGdt+Aw+ + +C +
   Q: 133 VCGSVWGQNDLAYRCRTCEHDPTCAICVPCFQNGNHKDHDYSIMYTG-GGCCDCGDTTAWKREGFCSRH 200
    6*****************************************97666.9*****************988 PP
   

Organism Oryza glaberrima
Protein Sequence
(Fasta)
MAGMDGGGGP SDAPPELSTQ ELIEQFSNVP GIVAPLQKLI LFGVPQEQLQ EHQEGLLIYL 60
EEHKELIPEI AKLVLSVGAD LLEARKASNK DGDSSNSEAC DEILSWLQWL MFNNEPHAML 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ogl-077571|E3,UBR-box|Oryza glaberrima
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGCTGGGA TGGATGGCGG CGGGGGCCCC TCCGACGCGC CGCCGGAGTT GTCCACGCAG 60
GAGCTCATCG AGCAGGTCCG TCTCTTTCCT CTTGATCCGT TCCGTGCTCG ATCCCCCGCA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ogl-077571|E3,UBR-box|Oryza glaberrima
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR013083--Znf_RING/FYVE/PHD
IPR003126--Znf_UBR

PROSITE

PS51157--ZF_UBR

Pfam

PF02207--zf-UBR

SMART

SM00396--ZnF_UBR1

Gene Ontology

GO:0004842--F:ubiquitin-protein transferase activity
GO:0008270--F:zinc ion binding
GO:0050994--P:regulation of lipid catabolic process
GO:0010029--P:regulation of seed germination
GO:0009737--P:response to abscisic acid
GO:0006511--P:ubiquitin-dependent protein catabolic process

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000949 Aegilops tauschii 68.68 0.00e+00 2232.00
IUUC-Aml-002071 Ailuropoda melanoleuca 40.74 3.00e-27 116.00
IUUC-Atr-002501 Amborella trichopoda 44.61 0.00e+00 969.00
IUUC-Apl-003828 Anas platyrhynchos 25.68 6.00e-30 126.00
IUUC-Aca-004832 Anolis carolinensis 41.04 1.00e-27 117.00
IUUC-Aly-005901 Arabidopsis lyrata 40.87 0.00e+00 1186.00
IUUC-Ath-007148 Arabidopsis thaliana 40.62 0.00e+00 1201.00
IUUC-Ago-007752 Ashbya gossypii 36.84 1.00e-09 59.30
IUUC-Acl-008055 Aspergillus clavatus 35.04 2.00e-16 81.60
IUUC-Afl-008479 Aspergillus flavus 35.38 2.00e-17 85.10
IUUC-Afu-008929 Aspergillus fumigatus 30.90 7.00e-18 86.70
IUUC-Ani-009334 Aspergillus nidulans 35.17 2.00e-17 84.70
IUUC-Ang-009550 Aspergillus niger 35.71 5.00e-17 83.60
IUUC-Aor-010124 Aspergillus oryzae 35.38 2.00e-17 85.10
IUUC-Ate-010550 Aspergillus terreus 34.38 3.00e-16 81.30
IUUC-Ame-011231 Astyanax mexicanus 44.60 2.00e-13 71.60
IUUC-Bgr-011999 Blumeria graminis 24.03 3.00e-15 77.80
IUUC-Bta-012768 Bos taurus 26.32 1.00e-29 125.00
IUUC-Bci-013834 Botrytis cinerea 35.19 5.00e-14 73.90
IUUC-Bdi-014635 Brachypodium distachyon 76.98 0.00e+00 2983.00
IUUC-Bol-015669 Brassica oleracea 41.09 0.00e+00 1288.00
IUUC-Bra-017776 Brassica rapa 41.26 0.00e+00 1320.00
IUUC-Cel-018476 Caenorhabditis elegans 29.52 1.00e-19 92.40
IUUC-Cja-019761 Callithrix jacchus 40.74 2.00e-27 117.00
IUUC-Cfa-020950 Canis familiaris 30.71 3.00e-23 104.00
IUUC-Cpo-021462 Cavia porcellus 41.04 8.00e-26 111.00
IUUC-Csa-024082 Chlorocebus sabaeus 28.45 3.00e-21 97.80
IUUC-Cho-025029 Choloepus hoffmanni 30.60 3.00e-22 100.00
IUUC-Cin-025110 Ciona intestinalis 28.57 3.00e-22 100.00
IUUC-Csv-026296 Ciona savignyi 30.67 6.00e-18 84.00
IUUC-Cgl-026605 Colletotrichum gloeosporioides 24.38 4.00e-17 84.00
IUUC-Cne-026823 Cryptococcus neoformans 29.33 4.00e-14 73.90
IUUC-Dre-028343 Danio rerio 25.79 4.00e-32 133.00
IUUC-Dno-029345 Dasypus novemcinctus 41.04 2.00e-27 116.00
IUUC-Dor-030207 Dipodomys ordii 31.67 1.00e-21 98.60
IUUC-Dse-031531 Dothistroma septosporum 28.63 1.00e-16 82.80
IUUC-Dme-032215 Drosophila melanogaster 42.37 3.00e-21 97.80
IUUC-Ete-033162 Echinops telfairi 36.88 7.00e-22 99.80
IUUC-Eca-033454 Equus caballus 28.46 2.00e-23 104.00
IUUC-Eeu-034783 Erinaceus europaeus 33.33 6.00e-21 96.70
IUUC-Fca-036588 Felis catus 31.32 3.00e-23 104.00
IUUC-Fal-037333 Ficedula albicollis 25.22 2.00e-30 128.00
IUUC-Fox-037984 Fusarium oxysporum 32.37 4.00e-18 87.40
IUUC-Fso-038463 Fusarium solani 32.17 3.00e-18 87.80
IUUC-Gmo-038976 Gadus morhua 43.38 4.00e-28 119.00
IUUC-Ggr-040070 Gaeumannomyces graminis 30.50 4.00e-15 77.80
IUUC-Gga-041123 Gallus gallus 31.62 5.00e-22 100.00
IUUC-Gac-042622 Gasterosteus aculeatus 35.54 4.00e-19 90.50
IUUC-Gma-043622 Glycine max 43.45 0.00e+00 1481.00
IUUC-Ggo-045583 Gorilla gorilla 28.45 3.00e-21 97.40
IUUC-Hsa-046343 Homo sapiens 28.49 5.00e-21 96.70
IUUC-Hvu-047707 Hordeum vulgare 72.78 0.00e+00 1931.00
IUUC-Itr-048464 Ictidomys tridecemlineatus 41.04 4.00e-27 117.00
IUUC-Kpa-049088 Komagataella pastoris 24.32 1.00e-13 72.00
IUUC-Lch-050205 Latimeria chalumnae 42.96 7.00e-29 122.00
IUUC-Lpe-051516 Leersia perrieri 87.92 0.00e+00 3597.00
IUUC-Loc-052818 Lepisosteus oculatus 35.33 3.00e-22 101.00
IUUC-Lma-053059 Leptosphaeria maculans 36.36 7.00e-18 86.70
IUUC-Laf-054142 Loxodonta africana 28.30 6.00e-22 99.80
IUUC-Mcc-055677 Macaca mulatta 28.15 6.00e-21 96.30
IUUC-Meu-056858 Macropus eugenii 38.52 4.00e-17 84.00
IUUC-Mor-057051 Magnaporthe oryzae 25.66 2.00e-17 85.50
IUUC-Mpo-057372 Magnaporthe poae 34.40 2.00e-15 78.20
IUUC-Mtr-058538 Medicago truncatula 43.62 0.00e+00 1449.00
IUUC-Mla-058963 Melampsora laricipopulina 25.36 2.00e-16 82.00
IUUC-Mga-059917 Meleagris gallopavo 25.38 6.00e-29 123.00
IUUC-Mvi-060535 Microbotryum violaceum 22.08 5.00e-22 100.00
IUUC-Mmr-060901 Microcebus murinus 28.78 6.00e-23 103.00
IUUC-Mdo-062306 Monodelphis domestica 24.47 2.00e-27 117.00
IUUC-Mmu-063389 Mus musculus 24.50 1.00e-26 115.00
IUUC-Mac-064773 Musa acuminata 53.28 0.00e+00 1852.00
IUUC-Mpu-066153 Mustela putorius furo 30.60 5.00e-22 100.00
IUUC-Mlu-068151 Myotis lucifugus 28.78 2.00e-21 98.20
IUUC-Nfi-068403 Neosartorya fischeri 30.93 5.00e-18 87.00
IUUC-Ncr-068864 Neurospora crassa 33.87 5.00e-17 84.00
IUUC-Nle-069529 Nomascus leucogenys 28.45 4.00e-21 97.40
IUUC-Opr-071107 Ochotona princeps 32.78 2.00e-20 94.70
IUUC-Ont-072035 Oreochromis niloticus 39.39 4.00e-19 90.50
IUUC-Oan-072893 Ornithorhynchus anatinus 31.62 5.00e-21 96.70
IUUC-Ocu-074930 Oryctolagus cuniculus 45.00 4.00e-22 100.00
IUUC-Oba-075295 Oryza barthii 96.13 0.00e+00 3832.00
IUUC-Obr-076117 Oryza brachyantha 88.30 0.00e+00 3583.00
IUUC-Ogu-078497 Oryza glumaepatula 95.16 0.00e+00 3782.00
IUUC-Oin-079343 Oryza indica 92.60 0.00e+00 3645.00
IUUC-Olo-081056 Oryza longistaminata 97.69 0.00e+00 3851.00
IUUC-Ome-081738 Oryza meridionalis 91.65 0.00e+00 3575.00
IUUC-Oni-083099 Oryza nivara 95.70 0.00e+00 3818.00
IUUC-Opu-083202 Oryza punctata 90.20 0.00e+00 3672.00
IUUC-Oru-084471 Oryza rufipogon 95.65 0.00e+00 3814.00
IUUC-Osa-085336 Oryza sativa 99.48 0.00e+00 1887.00
IUUC-Ola-086515 Oryzias latipes 41.79 2.00e-28 120.00
IUUC-Oga-088432 Otolemur garnettii 28.00 1.00e-22 102.00
IUUC-Oar-089557 Ovis aries 24.29 3.00e-26 114.00
IUUC-Ptr-091180 Pan troglodytes 28.45 5.00e-21 97.10
IUUC-Pan-092375 Papio anubis 28.45 2.00e-21 97.80
IUUC-Psi-093049 Pelodiscus sinensis 31.47 6.00e-21 96.70
IUUC-Pma-094152 Petromyzon marinus 32.94 2.00e-22 100.00
IUUC-Pno-094877 Phaeosphaeria nodorum 39.10 2.00e-19 91.30
IUUC-Ppa-095715 Physcomitrella patens 34.11 0.00e+00 1038.00
IUUC-Pfo-097124 Poecilia formosa 39.39 2.00e-18 88.60
IUUC-Pab-098783 Pongo abelii 40.74 4.00e-27 115.00
IUUC-Pop-099496 Populus trichocarpa 44.16 0.00e+00 1017.00
IUUC-Pca-101009 Procavia capensis 41.04 4.00e-27 117.00
IUUC-Ppe-101802 Prunus persica 44.56 0.00e+00 1396.00
IUUC-Pva-102538 Pteropus vampyrus 29.38 3.00e-24 107.00
IUUC-Pgr-103372 Puccinia graminis 33.33 9.00e-21 96.30
IUUC-Ptt-103878 Puccinia triticina 47.83 4.00e-07 50.80
IUUC-Pte-104174 Pyrenophora teres 37.59 4.00e-18 87.40
IUUC-Pyt-104431 Pyrenophora triticirepentis 38.35 8.00e-19 89.70
IUUC-Rno-105474 Rattus norvegicus 38.96 2.00e-20 94.00
IUUC-Sce-106200 Saccharomyces cerevisiae 33.68 1.00e-10 62.40
IUUC-Sha-106980 Sarcophilus harrisii 24.48 8.00e-28 119.00
IUUC-Sja-107980 Schizosaccharomyces japonicus 28.87 2.00e-20 94.70
IUUC-Spo-108183 Schizosaccharomyces pombe 32.07 2.00e-22 101.00
IUUC-Smo-108719 Selaginella moellendorffii 36.31 0.00e+00 665.00
IUUC-Sit-110716 Setaria italica 77.03 0.00e+00 3059.00
IUUC-Sly-111286 Solanum lycopersicum 44.45 0.00e+00 1539.00
IUUC-Sar-112948 Sorex araneus 41.79 1.00e-27 117.00
IUUC-Sbi-114577 Sorghum bicolor 75.22 0.00e+00 2900.00
IUUC-Sre-115045 Sporisorium reilianum 35.62 1.00e-16 82.80
IUUC-Ssc-115768 Sus scrofa 38.31 7.00e-20 92.80
IUUC-Tgu-116943 Taeniopygia guttata 31.62 3.00e-22 100.00
IUUC-Tru-117782 Takifugu rubripes 41.83 2.00e-21 98.60
IUUC-Tsy-119032 Tarsius syrichta 28.78 4.00e-23 103.00
IUUC-Tni-120560 Tetraodon nigroviridis 43.07 3.00e-29 122.00
IUUC-Tca-121077 Theobroma cacao 45.14 0.00e+00 1551.00
IUUC-Tre-122137 Trichoderma reesei 36.76 6.00e-18 86.70
IUUC-Tvi-122272 Trichoderma virens 26.72 5.00e-17 84.00
IUUC-Tae-125358 Triticum aestivum 74.93 0.00e+00 2864.00
IUUC-Tur-126562 Triticum urartu 65.04 0.00e+00 1486.00
IUUC-Tme-127156 Tuber melanosporum 23.12 2.00e-17 85.50
IUUC-Tbe-127964 Tupaia belangeri 41.04 3.00e-27 115.00
IUUC-Ttr-128253 Tursiops truncatus 28.78 3.00e-23 104.00
IUUC-Uma-129344 Ustilago maydis 35.29 2.00e-17 85.10
IUUC-Vda-129778 Verticillium dahliae 31.69 2.00e-16 81.60
IUUC-Vpa-130540 Vicugna pacos 36.55 8.00e-18 86.30
IUUC-Vvi-131290 Vitis vinifera 43.03 0.00e+00 1197.00
IUUC-Xtr-132335 Xenopus tropicalis 42.22 3.00e-28 119.00
IUUC-Xma-134112 Xiphophorus maculatus 39.39 2.00e-18 88.20
IUUC-Yli-134662 Yarrowia lipolytica 30.48 7.00e-13 69.70
IUUC-Zma-135553 Zea mays 73.43 0.00e+00 2791.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved