• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • miRNAMap
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Cne-026864
Ensembl Protein ID AAW41362
UniProt Accession P0CS16; Q55YQ1; Q5KN22; UBC2_CRYNJ
Genbank Protein ID AAW41362.1
Protein Name Ubiquitin-conjugating enzyme E2 2; E2 ubiquitin-conjugating enzyme 2; Ubiquitin carrier protein UBC2; Ubiquitin-protein ligase UBC2
Genbank Nucleotide ID AE017341
Gene Name UBC2; CNA08010
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CNA08010 AAW41362 AAW41362
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 4.20e-50 167.5 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl +++k+l++d p gis +p+ + +++ w+++i+Gp++tp+e+g F+l+++f++ YP kPP+v+f++k+fhPn+y+nG++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLIRDFKRLTSDAPIGISGSPNPD-NIMVWNAVIFGPPETPFEDGSFRLTLTFTDAYPNKPPTVRFISKMFHPNIYANGELCLDILQ--NRWSPTYDVAAI 105
    899*********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+s+qsll++pnp+sp+n++aa+l+k+n +ey+++v+
   Q: 106 LTSVQSLLNDPNPASPANVDAAQLFKENLKEYERRVK 142
    ***********************************98 PP
   

Organism Cryptococcus neoformans
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Protein Sequence
(Fasta)
MSTAAKRRLI RDFKRLTSDA PIGISGSPNP DNIMVWNAVI FGPPETPFED GSFRLTLTFT 60
DAYPNKPPTV RFISKMFHPN IYANGELCLD ILQNRWSPTY DVAAILTSVQ SLLNDPNPAS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cne-026864|E2,E2/UBC|Cryptococcus neoformans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TTGAGCCACT CAACTCGCAC GACCATCTTC ATTTGCCCTA TCCTAATTTT TGTCTGCCTG 60
AACTAGCTCG CAATGGTAAG TCCAATGCGT CTGTAATACA TCTGCAAAGT CTTCGCTTGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cne-026864|E2,E2/UBC|Cryptococcus neoformans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0156--Chromatin regulator
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0227--DNA damage
KW-0234--DNA repair
KW-0547--Nucleotide-binding
KW-0539--Nucleus
KW-1185--Reference proteome
KW-0749--Sporulation
KW-0804--Transcription
KW-0805--Transcription regulation
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0033503--C:HULC complex
GO:0000790--C:nuclear chromatin
GO:0005524--F:ATP binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0006281--P:DNA repair
GO:0016574--P:histone ubiquitination
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0000209--P:protein polyubiquitination
GO:0006355--P:regulation of transcription, DNA-templated
GO:0030435--P:sporulation resulting in formation of a cellular spore
GO:0006351--P:transcription, DNA-templated

KEGG cne:CNA08010
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 67.33 1.00e-61 226.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.08 4.00e-65 237.00
IUUC-Atr-002862 Amborella trichopoda 69.48 4.00e-63 231.00
IUUC-Apl-004063 Anas platyrhynchos 63.09 2.00e-55 205.00
IUUC-Aca-005001 Anolis carolinensis 69.08 6.00e-65 237.00
IUUC-Aly-006336 Arabidopsis lyrata 67.33 1.00e-55 206.00
IUUC-Ath-007547 Arabidopsis thaliana 67.33 1.00e-55 206.00
IUUC-Ago-007745 Ashbya gossypii 71.14 3.00e-65 238.00
IUUC-Acl-008139 Aspergillus clavatus 70.20 5.00e-65 237.00
IUUC-Afl-008551 Aspergillus flavus 70.20 3.00e-65 238.00
IUUC-Afu-008980 Aspergillus fumigatus 70.20 3.00e-65 238.00
IUUC-Ang-009554 Aspergillus niger 70.20 3.00e-65 238.00
IUUC-Aor-010242 Aspergillus oryzae 70.20 3.00e-65 238.00
IUUC-Ate-010390 Aspergillus terreus 70.20 3.00e-65 238.00
IUUC-Ame-011594 Astyanax mexicanus 71.52 3.00e-66 241.00
IUUC-Bgr-012039 Blumeria graminis 67.65 1.00e-57 212.00
IUUC-Bta-012840 Bos taurus 69.08 4.00e-65 237.00
IUUC-Bci-013919 Botrytis cinerea 71.05 3.00e-67 245.00
IUUC-Bdi-014308 Brachypodium distachyon 69.33 8.00e-63 230.00
IUUC-Bol-016084 Brassica oleracea 69.33 2.00e-62 229.00
IUUC-Bra-016643 Brassica rapa 69.33 2.00e-62 229.00
IUUC-Cel-018244 Caenorhabditis elegans 66.06 6.00e-66 241.00
IUUC-Cja-018783 Callithrix jacchus 71.52 3.00e-66 241.00
IUUC-Cfa-020646 Canis familiaris 71.52 4.00e-66 242.00
IUUC-Cpo-021323 Cavia porcellus 72.19 2.00e-66 242.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 66.45 9.00e-55 203.00
IUUC-Csa-023588 Chlorocebus sabaeus 71.52 3.00e-66 241.00
IUUC-Cho-024773 Choloepus hoffmanni 55.26 1.00e-45 173.00
IUUC-Cin-025537 Ciona intestinalis 65.56 6.00e-51 191.00
IUUC-Csv-025846 Ciona savignyi 67.11 3.00e-55 204.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 71.52 5.00e-67 244.00
IUUC-Cme-027284 Cyanidioschyzon merolae 60.26 1.00e-47 180.00
IUUC-Dre-028774 Danio rerio 71.05 2.00e-66 242.00
IUUC-Dno-029661 Dasypus novemcinctus 69.08 4.00e-65 237.00
IUUC-Dor-030452 Dipodomys ordii 68.38 2.00e-57 212.00
IUUC-Dse-031487 Dothistroma septosporum 70.86 8.00e-66 240.00
IUUC-Dme-031863 Drosophila melanogaster 72.19 9.00e-67 243.00
IUUC-Ete-032595 Echinops telfairi 68.46 1.00e-63 232.00
IUUC-Eca-033377 Equus caballus 69.08 4.00e-65 237.00
IUUC-Eeu-035191 Erinaceus europaeus 55.56 7.00e-45 170.00
IUUC-Fca-036581 Felis catus 71.52 3.00e-66 241.00
IUUC-Fal-037474 Ficedula albicollis 73.73 5.00e-53 197.00
IUUC-Fox-037808 Fusarium oxysporum 71.52 5.00e-67 244.00
IUUC-Fso-038232 Fusarium solani 71.52 6.00e-67 244.00
IUUC-Gmo-038517 Gadus morhua 71.52 3.00e-66 241.00
IUUC-Ggr-039875 Gaeumannomyces graminis 71.81 1.00e-66 243.00
IUUC-Gga-040588 Gallus gallus 71.52 3.00e-66 241.00
IUUC-Gac-041504 Gasterosteus aculeatus 71.52 8.00e-66 240.00
IUUC-Gma-043883 Glycine max 69.33 5.00e-63 230.00
IUUC-Ggo-044896 Gorilla gorilla 71.52 3.00e-66 241.00
IUUC-Hsa-046383 Homo sapiens 71.52 3.00e-66 241.00
IUUC-Hvu-047054 Hordeum vulgare 67.33 1.00e-61 226.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 71.52 3.00e-66 241.00
IUUC-Kpa-049225 Komagataella pastoris 68.46 8.00e-63 230.00
IUUC-Lch-049964 Latimeria chalumnae 71.52 3.00e-66 241.00
IUUC-Lpe-051301 Leersia perrieri 69.33 7.00e-63 230.00
IUUC-Loc-051731 Lepisosteus oculatus 71.52 3.00e-66 241.00
IUUC-Laf-053680 Loxodonta africana 71.52 3.00e-66 241.00
IUUC-Mcc-055546 Macaca mulatta 71.52 7.00e-66 241.00
IUUC-Meu-056231 Macropus eugenii 71.52 3.00e-66 241.00
IUUC-Mor-057087 Magnaporthe oryzae 70.90 4.00e-58 214.00
IUUC-Mpo-057498 Magnaporthe poae 71.81 1.00e-66 244.00
IUUC-Mtr-058305 Medicago truncatula 69.80 5.00e-63 231.00
IUUC-Mla-058876 Melampsora laricipopulina 77.48 1.00e-64 236.00
IUUC-Mga-059863 Meleagris gallopavo 68.12 4.00e-58 214.00
IUUC-Mvi-060330 Microbotryum violaceum 78.21 5.00e-64 234.00
IUUC-Mmr-060630 Microcebus murinus 69.08 4.00e-65 237.00
IUUC-Mdo-062292 Monodelphis domestica 71.52 3.00e-66 241.00
IUUC-Mmu-063680 Mus musculus 71.52 3.00e-66 241.00
IUUC-Mac-065428 Musa acuminata 68.46 3.00e-62 229.00
IUUC-Mpu-065803 Mustela putorius furo 69.08 4.00e-65 237.00
IUUC-Mlu-067147 Myotis lucifugus 69.08 4.00e-65 237.00
IUUC-Nfi-068580 Neosartorya fischeri 70.20 3.00e-65 238.00
IUUC-Ncr-068913 Neurospora crassa 71.52 3.00e-67 244.00
IUUC-Nle-069121 Nomascus leucogenys 71.52 3.00e-66 241.00
IUUC-Opr-070935 Ochotona princeps 69.08 4.00e-65 237.00
IUUC-Ont-071335 Oreochromis niloticus 70.39 1.00e-65 239.00
IUUC-Oan-072706 Ornithorhynchus anatinus 64.63 2.00e-58 215.00
IUUC-Ocu-074550 Oryctolagus cuniculus 71.52 5.00e-66 241.00
IUUC-Oba-075847 Oryza barthii 69.33 1.00e-62 230.00
IUUC-Obr-076713 Oryza brachyantha 69.33 7.00e-63 230.00
IUUC-Ogl-076956 Oryza glaberrima 69.33 8.00e-63 230.00
IUUC-Ogu-078696 Oryza glumaepatula 69.33 7.00e-63 230.00
IUUC-Oin-080106 Oryza indica 69.33 8.00e-63 230.00
IUUC-Olo-081018 Oryza longistaminata 54.84 4.00e-55 205.00
IUUC-Ome-081285 Oryza meridionalis 69.33 7.00e-63 230.00
IUUC-Oni-082088 Oryza nivara 69.33 7.00e-63 230.00
IUUC-Opu-083310 Oryza punctata 69.33 7.00e-63 230.00
IUUC-Oru-084449 Oryza rufipogon 69.33 7.00e-63 230.00
IUUC-Osa-086191 Oryza sativa 69.33 8.00e-63 230.00
IUUC-Ola-086407 Oryzias latipes 71.52 3.00e-66 241.00
IUUC-Olu-087830 Ostreococcus lucimarinus 63.09 7.00e-51 190.00
IUUC-Oga-088659 Otolemur garnettii 71.52 3.00e-66 241.00
IUUC-Oar-090141 Ovis aries 69.08 4.00e-65 237.00
IUUC-Ptr-091305 Pan troglodytes 71.52 3.00e-66 241.00
IUUC-Pan-092740 Papio anubis 71.52 7.00e-66 241.00
IUUC-Psi-094094 Pelodiscus sinensis 71.52 3.00e-66 241.00
IUUC-Pma-094376 Petromyzon marinus 69.74 4.00e-65 238.00
IUUC-Pno-094935 Phaeosphaeria nodorum 71.52 2.00e-66 242.00
IUUC-Ppa-095689 Physcomitrella patens 72.44 2.00e-54 202.00
IUUC-Pfo-096656 Poecilia formosa 70.86 4.00e-66 241.00
IUUC-Pab-097972 Pongo abelii 71.52 3.00e-66 241.00
IUUC-Pop-099517 Populus trichocarpa 69.33 5.00e-63 230.00
IUUC-Pca-100906 Procavia capensis 66.23 9.00e-60 220.00
IUUC-Ppe-101594 Prunus persica 69.33 7.00e-63 230.00
IUUC-Pva-102380 Pteropus vampyrus 70.86 2.00e-64 235.00
IUUC-Pgr-103611 Puccinia graminis 75.82 8.00e-65 237.00
IUUC-Ptt-103971 Puccinia triticina 75.83 2.00e-49 185.00
IUUC-Pte-104378 Pyrenophora teres 72.19 6.00e-67 244.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 72.19 6.00e-67 244.00
IUUC-Rno-105772 Rattus norvegicus 69.08 2.00e-65 239.00
IUUC-Sce-106283 Saccharomyces cerevisiae 71.14 3.00e-65 238.00
IUUC-Sha-107650 Sarcophilus harrisii 68.42 7.00e-64 233.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 73.83 1.00e-58 216.00
IUUC-Spo-108073 Schizosaccharomyces pombe 73.83 9.00e-59 216.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 71.05 3.00e-67 245.00
IUUC-Smo-109036 Selaginella moellendorffii 68.67 2.00e-62 229.00
IUUC-Sit-110731 Setaria italica 69.33 7.00e-63 230.00
IUUC-Sly-111506 Solanum lycopersicum 68.67 1.00e-62 229.00
IUUC-Stu-112080 Solanum tuberosum 68.67 1.00e-62 229.00
IUUC-Sar-113429 Sorex araneus 69.08 4.00e-65 237.00
IUUC-Sbi-114289 Sorghum bicolor 69.33 7.00e-63 230.00
IUUC-Sre-115106 Sporisorium reilianum 74.68 5.00e-64 234.00
IUUC-Ssc-116265 Sus scrofa 71.52 3.00e-66 241.00
IUUC-Tgu-117383 Taeniopygia guttata 71.52 3.00e-66 241.00
IUUC-Tru-118576 Takifugu rubripes 69.08 3.00e-65 238.00
IUUC-Tsy-119000 Tarsius syrichta 69.08 4.00e-65 237.00
IUUC-Tni-119745 Tetraodon nigroviridis 68.42 8.00e-65 236.00
IUUC-Tca-121827 Theobroma cacao 70.00 4.00e-63 231.00
IUUC-Tre-122002 Trichoderma reesei 71.52 5.00e-67 244.00
IUUC-Tvi-122331 Trichoderma virens 71.52 5.00e-67 244.00
IUUC-Tae-125400 Triticum aestivum 69.33 7.00e-63 230.00
IUUC-Tur-126866 Triticum urartu 68.00 3.00e-62 228.00
IUUC-Tme-127148 Tuber melanosporum 70.47 3.00e-65 238.00
IUUC-Tbe-127921 Tupaia belangeri 67.11 1.00e-60 223.00
IUUC-Ttr-129050 Tursiops truncatus 71.52 3.00e-65 238.00
IUUC-Uma-129561 Ustilago maydis 73.42 2.00e-64 235.00
IUUC-Vda-129711 Verticillium dahliae 71.52 5.00e-67 244.00
IUUC-Vpa-130570 Vicugna pacos 63.24 8.00e-52 193.00
IUUC-Vvi-131547 Vitis vinifera 69.33 5.00e-63 231.00
IUUC-Xtr-132301 Xenopus tropicalis 71.52 3.00e-66 241.00
IUUC-Xma-133937 Xiphophorus maculatus 71.52 3.00e-66 241.00
IUUC-Yli-134660 Yarrowia lipolytica 68.87 2.00e-65 238.00
IUUC-Zma-135584 Zea mays 68.46 4.00e-62 228.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved