• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Apl-004063
Ensembl Protein ID ENSAPLP00000014685.1
UniProt Accession U3J5A8; U3J5A8_ANAPL
Genbank Protein ID ENSAPLP00000014685
Protein Name Uncharacterized protein
Genbank Nucleotide ID ADON01015461
Gene Name UBE2B
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSAPLG00000014846.1 ENSAPLT00000015468.1 ENSAPLP00000014685.1
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.90e-47 160.2 2 139
Active Site
Position(s) Description Evidence
85 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 9    lekdppegisakpvdesdltewevlilGpedtpYegg...........vFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsil 86
    l++dpp g+s p+++ ++++w+++i+Gpe+tp+e+g +Fkl ief+e+YP kPP+v+fl+k+fhPnvy++G++Cl+il
   Q: 2 LQEDPPVGVSGAPSEN-NIMQWNAVIFGPEGTPFEDGkqivfmfvwtgTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 89
    89************99.9*****************86333333333227**************************************** PP
   S: 87 keeekWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    + ++Wsp+++v+s+l+siqsll+epnp+sp+n++aa+l+++n++ey+k+v+
   Q: 90 Q--NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVS 139
    9..**********************************************996 PP
   

Organism Anas platyrhynchos
Protein Sequence
(Fasta)
RLQEDPPVGV SGAPSENNIM QWNAVIFGPE GTPFEDGKQI VFMFVWTGTF KLVIEFSEEY 60
PNKPPTVRFL SKMFHPNVYA DGSICLDILQ NRWSPTYDVS SILTSIQSLL DEPNPNSPAN 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Apl-004063|E2,E2/UBC|Anas platyrhynchos
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AGGTTGCAAG AAGACCCTCC TGTGGGTGTC AGTGGTGCAC CGTCTGAGAA TAATATAATG 60
CAGTGGAATG CAGTTATATT TGGGTAAGAG CTTTTGGTCG CTACCAAGTC CTACATCAAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Apl-004063|E2,E2/UBC|Anas platyrhynchos
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0033503--C:HULC complex
GO:0000790--C:nuclear chromatin
GO:0005657--C:replication fork
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0060070--P:canonical Wnt signaling pathway
GO:0051026--P:chiasma assembly
GO:0033522--P:histone H2A ubiquitination
GO:0070076--P:histone lysine demethylation
GO:0006344--P:maintenance of chromatin silencing
GO:0045141--P:meiotic telomere clustering
GO:0043066--P:negative regulation of apoptotic process
GO:0043951--P:negative regulation of cAMP-mediated signaling
GO:0033128--P:negative regulation of histone phosphorylation
GO:0010845--P:positive regulation of reciprocal meiotic recombination
GO:0006301--P:postreplication repair
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051865--P:protein autoubiquitination
GO:0070979--P:protein K11-linked ubiquitination
GO:0070936--P:protein K48-linked ubiquitination
GO:0070534--P:protein K63-linked ubiquitination
GO:0006513--P:protein monoubiquitination
GO:0050821--P:protein stabilization
GO:0042493--P:response to drug
GO:0009411--P:response to UV
GO:0007288--P:sperm axoneme assembly
GO:0070193--P:synaptonemal complex organization

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 69.18 4.00e-58 216.00
IUUC-Aml-002120 Ailuropoda melanoleuca 92.62 2.00e-76 277.00
IUUC-Atr-002862 Amborella trichopoda 70.75 9.00e-60 221.00
IUUC-Aca-005001 Anolis carolinensis 91.95 2.00e-76 276.00
IUUC-Aly-005584 Arabidopsis lyrata 70.55 5.00e-59 219.00
IUUC-Ath-007149 Arabidopsis thaliana 70.55 5.00e-59 219.00
IUUC-Ago-007745 Ashbya gossypii 61.64 2.00e-51 194.00
IUUC-Acl-008139 Aspergillus clavatus 61.49 2.00e-53 200.00
IUUC-Afl-008551 Aspergillus flavus 61.49 3.00e-53 199.00
IUUC-Afu-008980 Aspergillus fumigatus 61.49 3.00e-53 199.00
IUUC-Ang-009554 Aspergillus niger 61.49 3.00e-53 199.00
IUUC-Aor-010242 Aspergillus oryzae 61.49 3.00e-53 199.00
IUUC-Ate-010390 Aspergillus terreus 61.49 3.00e-53 199.00
IUUC-Ame-011900 Astyanax mexicanus 87.92 1.00e-73 267.00
IUUC-Bgr-012039 Blumeria graminis 61.90 3.00e-53 199.00
IUUC-Bta-012840 Bos taurus 92.62 2.00e-76 277.00
IUUC-Bci-013919 Botrytis cinerea 61.74 3.00e-54 202.00
IUUC-Bdi-014475 Brachypodium distachyon 69.86 9.00e-59 218.00
IUUC-Bol-015726 Brassica oleracea 70.55 2.00e-58 219.00
IUUC-Bra-016643 Brassica rapa 70.55 5.00e-59 219.00
IUUC-Cel-018244 Caenorhabditis elegans 78.08 1.00e-65 241.00
IUUC-Cja-019737 Callithrix jacchus 92.62 2.00e-76 277.00
IUUC-Cfa-020244 Canis familiaris 92.62 2.00e-76 277.00
IUUC-Cpo-022192 Cavia porcellus 92.62 2.00e-76 277.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 69.84 4.00e-47 179.00
IUUC-Csa-023430 Chlorocebus sabaeus 92.62 2.00e-76 277.00
IUUC-Cho-025061 Choloepus hoffmanni 85.00 5.00e-55 205.00
IUUC-Cin-025537 Ciona intestinalis 73.15 5.00e-50 189.00
IUUC-Csv-025846 Ciona savignyi 74.15 3.00e-55 206.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 61.49 7.00e-54 202.00
IUUC-Cne-026864 Cryptococcus neoformans 63.70 2.00e-54 204.00
IUUC-Cme-027284 Cyanidioschyzon merolae 59.18 5.00e-43 167.00
IUUC-Dre-028774 Danio rerio 87.92 2.00e-73 267.00
IUUC-Dno-029661 Dasypus novemcinctus 92.62 2.00e-76 277.00
IUUC-Dor-030452 Dipodomys ordii 92.57 2.00e-75 273.00
IUUC-Dse-031487 Dothistroma septosporum 61.49 2.00e-53 200.00
IUUC-Dme-031863 Drosophila melanogaster 78.38 3.00e-65 239.00
IUUC-Ete-032595 Echinops telfairi 89.26 1.00e-73 267.00
IUUC-Eca-033377 Equus caballus 92.62 2.00e-76 277.00
IUUC-Eeu-035191 Erinaceus europaeus 70.27 9.00e-52 195.00
IUUC-Fca-036336 Felis catus 92.62 2.00e-76 277.00
IUUC-Fal-037474 Ficedula albicollis 86.92 4.00e-62 228.00
IUUC-Fox-037808 Fusarium oxysporum 61.49 1.00e-53 201.00
IUUC-Fso-038232 Fusarium solani 61.49 1.00e-53 201.00
IUUC-Gmo-038517 Gadus morhua 88.51 5.00e-73 265.00
IUUC-Ggr-039875 Gaeumannomyces graminis 61.64 6.00e-53 199.00
IUUC-Gga-040494 Gallus gallus 92.62 2.00e-76 277.00
IUUC-Gac-042471 Gasterosteus aculeatus 87.92 6.00e-74 268.00
IUUC-Gma-043865 Glycine max 70.55 2.00e-59 220.00
IUUC-Ggo-044580 Gorilla gorilla 92.62 4.00e-76 275.00
IUUC-Hsa-046239 Homo sapiens 92.62 2.00e-76 277.00
IUUC-Hvu-047054 Hordeum vulgare 69.18 4.00e-58 216.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 92.62 2.00e-76 277.00
IUUC-Kpa-049225 Komagataella pastoris 61.22 4.00e-51 193.00
IUUC-Lch-050283 Latimeria chalumnae 89.86 3.00e-74 269.00
IUUC-Lpe-051301 Leersia perrieri 70.55 5.00e-59 219.00
IUUC-Loc-051962 Lepisosteus oculatus 90.60 5.00e-75 272.00
IUUC-Laf-053380 Loxodonta africana 92.62 2.00e-76 277.00
IUUC-Mcc-054819 Macaca mulatta 92.62 6.00e-77 279.00
IUUC-Meu-056103 Macropus eugenii 92.57 2.00e-75 273.00
IUUC-Mor-057087 Magnaporthe oryzae 62.07 6.00e-52 195.00
IUUC-Mpo-057498 Magnaporthe poae 61.64 6.00e-53 199.00
IUUC-Mtr-058305 Medicago truncatula 70.55 2.00e-59 220.00
IUUC-Mla-058876 Melampsora laricipopulina 66.89 8.00e-49 185.00
IUUC-Mga-059863 Meleagris gallopavo 92.62 2.00e-76 276.00
IUUC-Mvi-060330 Microbotryum violaceum 65.99 2.00e-47 181.00
IUUC-Mmr-060630 Microcebus murinus 92.62 2.00e-76 277.00
IUUC-Mdo-062676 Monodelphis domestica 92.62 2.00e-76 277.00
IUUC-Mmu-063491 Mus musculus 92.62 2.00e-76 277.00
IUUC-Mac-064774 Musa acuminata 70.55 6.00e-59 219.00
IUUC-Mpu-065803 Mustela putorius furo 92.62 2.00e-76 277.00
IUUC-Mlu-067147 Myotis lucifugus 92.62 2.00e-76 277.00
IUUC-Nfi-068580 Neosartorya fischeri 61.49 3.00e-53 199.00
IUUC-Ncr-068913 Neurospora crassa 61.49 6.00e-54 202.00
IUUC-Nle-070105 Nomascus leucogenys 92.62 2.00e-76 277.00
IUUC-Opr-070935 Ochotona princeps 92.62 2.00e-76 277.00
IUUC-Ont-071335 Oreochromis niloticus 87.92 1.00e-73 268.00
IUUC-Oan-072706 Ornithorhynchus anatinus 92.62 2.00e-76 276.00
IUUC-Ocu-074130 Oryctolagus cuniculus 92.62 2.00e-76 277.00
IUUC-Oba-075896 Oryza barthii 69.86 2.00e-58 217.00
IUUC-Obr-076713 Oryza brachyantha 70.55 5.00e-59 219.00
IUUC-Ogl-077116 Oryza glaberrima 70.55 5.00e-59 219.00
IUUC-Ogu-078696 Oryza glumaepatula 70.55 5.00e-59 219.00
IUUC-Oin-079099 Oryza indica 70.55 5.00e-59 219.00
IUUC-Olo-081018 Oryza longistaminata 62.09 8.00e-53 199.00
IUUC-Ome-081285 Oryza meridionalis 70.55 5.00e-59 219.00
IUUC-Oni-082088 Oryza nivara 70.55 5.00e-59 219.00
IUUC-Opu-083310 Oryza punctata 70.55 5.00e-59 219.00
IUUC-Oru-084449 Oryza rufipogon 70.55 5.00e-59 219.00
IUUC-Osa-085923 Oryza sativa 70.55 5.00e-59 219.00
IUUC-Ola-087160 Oryzias latipes 87.92 1.00e-73 268.00
IUUC-Olu-087830 Ostreococcus lucimarinus 71.23 4.00e-50 189.00
IUUC-Oga-088836 Otolemur garnettii 92.62 2.00e-76 277.00
IUUC-Oar-090141 Ovis aries 92.62 2.00e-76 277.00
IUUC-Ptr-091453 Pan troglodytes 92.62 2.00e-76 277.00
IUUC-Pan-092511 Papio anubis 92.62 2.00e-76 277.00
IUUC-Psi-093968 Pelodiscus sinensis 91.95 2.00e-76 276.00
IUUC-Pma-094239 Petromyzon marinus 87.16 3.00e-72 263.00
IUUC-Pno-094935 Phaeosphaeria nodorum 61.49 6.00e-54 202.00
IUUC-Ppa-095689 Physcomitrella patens 71.23 5.00e-50 189.00
IUUC-Pfo-096496 Poecilia formosa 87.92 6.00e-74 268.00
IUUC-Pab-098121 Pongo abelii 92.62 2.00e-76 277.00
IUUC-Pop-099517 Populus trichocarpa 70.55 3.00e-59 219.00
IUUC-Pca-100906 Procavia capensis 81.76 3.00e-65 239.00
IUUC-Ppe-101594 Prunus persica 70.55 6.00e-59 219.00
IUUC-Pva-102380 Pteropus vampyrus 87.16 2.00e-71 260.00
IUUC-Pgr-103611 Puccinia graminis 66.22 5.00e-49 186.00
IUUC-Ptt-103971 Puccinia triticina 66.67 1.00e-41 161.00
IUUC-Pte-104378 Pyrenophora teres 62.16 3.00e-54 203.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 62.16 3.00e-54 203.00
IUUC-Rno-105772 Rattus norvegicus 92.62 5.00e-77 279.00
IUUC-Sce-106283 Saccharomyces cerevisiae 61.64 2.00e-51 194.00
IUUC-Sha-107650 Sarcophilus harrisii 91.28 1.00e-74 271.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 64.38 6.00e-48 182.00
IUUC-Spo-108073 Schizosaccharomyces pombe 64.38 4.00e-48 182.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 61.74 3.00e-54 202.00
IUUC-Smo-109036 Selaginella moellendorffii 71.23 2.00e-59 220.00
IUUC-Sit-110731 Setaria italica 70.55 5.00e-59 219.00
IUUC-Sly-111506 Solanum lycopersicum 71.23 2.00e-59 220.00
IUUC-Stu-112080 Solanum tuberosum 71.23 2.00e-59 220.00
IUUC-Sar-113429 Sorex araneus 92.62 2.00e-76 277.00
IUUC-Sbi-114289 Sorghum bicolor 70.55 5.00e-59 219.00
IUUC-Sre-115106 Sporisorium reilianum 68.92 4.00e-50 190.00
IUUC-Ssc-115257 Sus scrofa 90.60 2.00e-74 270.00
IUUC-Tgu-116604 Taeniopygia guttata 95.30 1.00e-80 290.00
IUUC-Tru-117924 Takifugu rubripes 89.26 5.00e-69 252.00
IUUC-Tsy-119000 Tarsius syrichta 92.62 2.00e-76 277.00
IUUC-Tni-119745 Tetraodon nigroviridis 87.25 2.00e-72 263.00
IUUC-Tca-121827 Theobroma cacao 70.55 2.00e-59 220.00
IUUC-Tre-122002 Trichoderma reesei 61.49 1.00e-53 201.00
IUUC-Tvi-122331 Trichoderma virens 61.49 1.00e-53 201.00
IUUC-Tae-125807 Triticum aestivum 69.86 1.00e-58 218.00
IUUC-Tur-126866 Triticum urartu 69.86 1.00e-58 218.00
IUUC-Tme-127148 Tuber melanosporum 63.70 6.00e-54 202.00
IUUC-Tbe-127921 Tupaia belangeri 90.60 3.00e-72 263.00
IUUC-Ttr-129121 Tursiops truncatus 92.62 2.00e-76 277.00
IUUC-Uma-129561 Ustilago maydis 68.92 2.00e-50 190.00
IUUC-Vda-129711 Verticillium dahliae 61.49 7.00e-54 202.00
IUUC-Vpa-130570 Vicugna pacos 86.49 1.00e-68 250.00
IUUC-Vvi-131108 Vitis vinifera 71.92 8.00e-60 221.00
IUUC-Xtr-131824 Xenopus tropicalis 91.28 3.00e-75 273.00
IUUC-Xma-133667 Xiphophorus maculatus 87.92 1.00e-73 268.00
IUUC-Yli-134660 Yarrowia lipolytica 58.78 1.00e-52 197.00
IUUC-Zma-135627 Zea mays 64.33 1.00e-60 224.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved