• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mor-057087
Ensembl Protein ID MGG_01756T0
UniProt Accession G4MVC5; G4MVC5_MAGO7
Genbank Protein ID EHA54947.1
Protein Name Ubiquitin-conjugating enzyme E2 2
Genbank Nucleotide ID CM001232
Gene Name MGG_01756
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
MGG_01756 MGG_01756T0 MGG_01756T0
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 2.20e-48 162.9 1 128
Active Site
Position(s) Description Evidence
73 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 9    lekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesvllsiq 106
    +++dpp+g+sa+pv + ++++w+++i+Gp dtp+e+g+F+l ++f+e+YP kPP+vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ +l+siq
   Q: 1 MQTDPPAGVSASPVPD-NVMTWNAVIIGPGDTPFEDGTFRLVMHFEEQYPNKPPSVKFISQMFHPNVYATGELCLDILQ--NRWSPTYDVAAILTSIQ 95
    689*************.9************************************************************9..***************** PP
   S: 107 sllaepnpesplneeaaellkknreeykkkvre 139
    sll++pn+ sp+n+ea++l+k+nr+ey k+vre
   Q: 96 SLLNDPNTGSPANVEASNLYKDNRKEYIKRVRE 128
    ******************************985 PP
   

Organism Magnaporthe oryzae
Protein Sequence
(Fasta)
MQTDPPAGVS ASPVPDNVMT WNAVIIGPGD TPFEDGTFRL VMHFEEQYPN KPPSVKFISQ 60
MFHPNVYATG ELCLDILQNR WSPTYDVAAI LTSIQSLLND PNTGSPANVE ASNLYKDNRK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mor-057087|E2,E2/UBC|Magnaporthe oryzae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTTGCTCACC AACGTACCGT AAGACTCCAC CGCTACAAAC CTTCAACTAT CGCAACGCCG 60
AACCAAGAGA TTCCGCCATC AGACCACCAT ATCTTCGAAA CAACAATCCC TGTCTGCCTC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mor-057087|E2,E2/UBC|Magnaporthe oryzae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG mgr:MGG_01756
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 62.77 3.00e-53 198.00
IUUC-Aml-002120 Ailuropoda melanoleuca 67.16 6.00e-55 204.00
IUUC-Atr-002623 Amborella trichopoda 64.23 7.00e-54 201.00
IUUC-Apl-004063 Anas platyrhynchos 62.07 3.00e-52 195.00
IUUC-Aca-004714 Anolis carolinensis 67.16 6.00e-55 204.00
IUUC-Aly-005584 Arabidopsis lyrata 63.50 1.00e-53 200.00
IUUC-Ath-007149 Arabidopsis thaliana 63.50 1.00e-53 200.00
IUUC-Ago-007745 Ashbya gossypii 75.56 7.00e-63 231.00
IUUC-Acl-008139 Aspergillus clavatus 95.56 1.00e-75 272.00
IUUC-Afl-008551 Aspergillus flavus 96.30 6.00e-76 274.00
IUUC-Afu-008980 Aspergillus fumigatus 96.30 6.00e-76 274.00
IUUC-Ang-009554 Aspergillus niger 96.30 6.00e-76 274.00
IUUC-Aor-010242 Aspergillus oryzae 96.30 6.00e-76 274.00
IUUC-Ate-010390 Aspergillus terreus 96.30 6.00e-76 274.00
IUUC-Ame-011900 Astyanax mexicanus 67.91 3.00e-55 205.00
IUUC-Bgr-012039 Blumeria graminis 91.85 3.00e-73 265.00
IUUC-Bta-012840 Bos taurus 67.16 6.00e-55 204.00
IUUC-Bci-013919 Botrytis cinerea 94.07 1.00e-74 270.00
IUUC-Bdi-015010 Brachypodium distachyon 64.23 1.00e-53 200.00
IUUC-Bol-016245 Brassica oleracea 63.50 1.00e-53 200.00
IUUC-Bra-018026 Brassica rapa 63.50 1.00e-53 200.00
IUUC-Cel-018244 Caenorhabditis elegans 70.15 3.00e-57 212.00
IUUC-Cja-019737 Callithrix jacchus 67.16 6.00e-55 204.00
IUUC-Cfa-020244 Canis familiaris 67.16 6.00e-55 204.00
IUUC-Cpo-021323 Cavia porcellus 67.41 3.00e-55 205.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.54 2.00e-44 169.00
IUUC-Csa-023430 Chlorocebus sabaeus 67.16 6.00e-55 204.00
IUUC-Cho-025061 Choloepus hoffmanni 66.36 8.00e-41 156.00
IUUC-Cin-025537 Ciona intestinalis 67.91 1.00e-45 173.00
IUUC-Csv-025846 Ciona savignyi 67.91 4.00e-49 184.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 96.30 1.00e-76 276.00
IUUC-Cne-026864 Cryptococcus neoformans 70.90 1.00e-57 213.00
IUUC-Cme-027284 Cyanidioschyzon merolae 60.74 1.00e-41 161.00
IUUC-Dre-028774 Danio rerio 67.16 6.00e-55 204.00
IUUC-Dno-029661 Dasypus novemcinctus 67.16 6.00e-55 204.00
IUUC-Dor-030452 Dipodomys ordii 67.16 6.00e-55 204.00
IUUC-Dse-031487 Dothistroma septosporum 94.81 3.00e-75 271.00
IUUC-Dme-031863 Drosophila melanogaster 68.66 3.00e-55 205.00
IUUC-Ete-032595 Echinops telfairi 65.67 1.00e-53 199.00
IUUC-Eca-033377 Equus caballus 67.16 6.00e-55 204.00
IUUC-Eeu-035191 Erinaceus europaeus 51.09 9.00e-35 137.00
IUUC-Fca-036336 Felis catus 67.16 6.00e-55 204.00
IUUC-Fal-037474 Ficedula albicollis 68.97 2.00e-48 181.00
IUUC-Fox-037808 Fusarium oxysporum 96.30 2.00e-76 275.00
IUUC-Fso-038232 Fusarium solani 95.56 5.00e-76 274.00
IUUC-Gmo-038517 Gadus morhua 67.16 6.00e-55 204.00
IUUC-Ggr-039875 Gaeumannomyces graminis 97.10 4.00e-79 284.00
IUUC-Gga-040494 Gallus gallus 67.16 6.00e-55 204.00
IUUC-Gac-042471 Gasterosteus aculeatus 67.16 2.00e-55 205.00
IUUC-Gma-043865 Glycine max 64.23 1.00e-54 203.00
IUUC-Ggo-044896 Gorilla gorilla 67.16 6.00e-55 204.00
IUUC-Hsa-046239 Homo sapiens 67.16 6.00e-55 204.00
IUUC-Hvu-047054 Hordeum vulgare 62.77 3.00e-53 198.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 67.16 6.00e-55 204.00
IUUC-Kpa-049225 Komagataella pastoris 82.09 1.00e-66 243.00
IUUC-Lch-049964 Latimeria chalumnae 67.16 6.00e-55 204.00
IUUC-Lpe-051301 Leersia perrieri 64.23 7.00e-54 201.00
IUUC-Loc-051962 Lepisosteus oculatus 68.66 1.00e-55 206.00
IUUC-Laf-053380 Loxodonta africana 67.16 6.00e-55 204.00
IUUC-Mcc-054819 Macaca mulatta 67.16 4.00e-55 205.00
IUUC-Meu-056103 Macropus eugenii 67.16 6.00e-55 204.00
IUUC-Mpo-057498 Magnaporthe poae 97.10 2.00e-79 286.00
IUUC-Mtr-058305 Medicago truncatula 64.23 3.00e-54 202.00
IUUC-Mla-058876 Melampsora laricipopulina 75.37 5.00e-56 208.00
IUUC-Mga-059863 Meleagris gallopavo 67.16 6.00e-55 204.00
IUUC-Mvi-060330 Microbotryum violaceum 74.10 5.00e-56 207.00
IUUC-Mmr-060630 Microcebus murinus 67.16 6.00e-55 204.00
IUUC-Mdo-062676 Monodelphis domestica 67.16 6.00e-55 204.00
IUUC-Mmu-063491 Mus musculus 67.16 6.00e-55 204.00
IUUC-Mac-065641 Musa acuminata 64.96 3.00e-54 201.00
IUUC-Mpu-065803 Mustela putorius furo 67.16 6.00e-55 204.00
IUUC-Mlu-067147 Myotis lucifugus 67.16 6.00e-55 204.00
IUUC-Nfi-068580 Neosartorya fischeri 96.30 6.00e-76 274.00
IUUC-Ncr-068913 Neurospora crassa 97.04 5.00e-77 277.00
IUUC-Nle-070105 Nomascus leucogenys 67.16 6.00e-55 204.00
IUUC-Opr-070935 Ochotona princeps 67.16 6.00e-55 204.00
IUUC-Ont-071335 Oreochromis niloticus 67.16 2.00e-55 205.00
IUUC-Oan-072706 Ornithorhynchus anatinus 67.16 7.00e-55 204.00
IUUC-Ocu-074130 Oryctolagus cuniculus 67.16 6.00e-55 204.00
IUUC-Oba-075896 Oryza barthii 64.23 1.00e-53 199.00
IUUC-Obr-076770 Oryza brachyantha 64.96 5.00e-54 201.00
IUUC-Ogl-077116 Oryza glaberrima 64.23 7.00e-54 201.00
IUUC-Ogu-078696 Oryza glumaepatula 64.23 7.00e-54 201.00
IUUC-Oin-079099 Oryza indica 64.23 7.00e-54 201.00
IUUC-Olo-081018 Oryza longistaminata 53.33 3.00e-43 166.00
IUUC-Ome-081285 Oryza meridionalis 64.23 7.00e-54 201.00
IUUC-Oni-082088 Oryza nivara 64.23 7.00e-54 201.00
IUUC-Opu-083310 Oryza punctata 64.23 7.00e-54 201.00
IUUC-Oru-084449 Oryza rufipogon 64.23 7.00e-54 201.00
IUUC-Osa-085923 Oryza sativa 64.23 7.00e-54 201.00
IUUC-Ola-087160 Oryzias latipes 67.16 2.00e-55 205.00
IUUC-Olu-087830 Ostreococcus lucimarinus 64.18 1.00e-44 170.00
IUUC-Oga-088836 Otolemur garnettii 67.16 6.00e-55 204.00
IUUC-Oar-090141 Ovis aries 67.16 6.00e-55 204.00
IUUC-Ptr-091453 Pan troglodytes 67.16 6.00e-55 204.00
IUUC-Pan-092511 Papio anubis 67.16 6.00e-55 204.00
IUUC-Psi-094094 Pelodiscus sinensis 67.16 6.00e-55 204.00
IUUC-Pma-094239 Petromyzon marinus 65.93 7.00e-55 204.00
IUUC-Pno-094935 Phaeosphaeria nodorum 91.85 2.00e-73 265.00
IUUC-Ppa-095689 Physcomitrella patens 67.86 8.00e-45 170.00
IUUC-Pfo-096656 Poecilia formosa 65.93 7.00e-55 204.00
IUUC-Pab-098121 Pongo abelii 67.16 6.00e-55 204.00
IUUC-Pop-099734 Populus trichocarpa 64.23 3.00e-48 182.00
IUUC-Pca-100906 Procavia capensis 60.74 1.00e-48 183.00
IUUC-Ppe-101594 Prunus persica 64.23 4.00e-54 201.00
IUUC-Pva-102380 Pteropus vampyrus 65.93 6.00e-53 197.00
IUUC-Pgr-103611 Puccinia graminis 75.37 3.00e-56 209.00
IUUC-Ptt-103971 Puccinia triticina 78.45 7.00e-49 183.00
IUUC-Pte-104378 Pyrenophora teres 93.33 3.00e-74 268.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 93.33 3.00e-74 268.00
IUUC-Rno-105772 Rattus norvegicus 67.16 4.00e-55 205.00
IUUC-Sce-106283 Saccharomyces cerevisiae 75.56 6.00e-63 231.00
IUUC-Sha-107650 Sarcophilus harrisii 66.42 9.00e-54 200.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 81.62 1.00e-58 216.00
IUUC-Spo-108073 Schizosaccharomyces pombe 80.88 2.00e-58 216.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 94.07 1.00e-74 270.00
IUUC-Smo-109036 Selaginella moellendorffii 64.23 6.00e-54 201.00
IUUC-Sit-110731 Setaria italica 64.23 7.00e-54 201.00
IUUC-Sly-111506 Solanum lycopersicum 64.23 2.00e-54 202.00
IUUC-Stu-112080 Solanum tuberosum 64.23 2.00e-54 202.00
IUUC-Sar-113429 Sorex araneus 67.16 6.00e-55 204.00
IUUC-Sbi-114289 Sorghum bicolor 64.23 7.00e-54 201.00
IUUC-Sre-115106 Sporisorium reilianum 72.66 2.00e-55 206.00
IUUC-Ssc-116265 Sus scrofa 67.16 6.00e-55 204.00
IUUC-Tgu-117383 Taeniopygia guttata 67.16 6.00e-55 204.00
IUUC-Tru-118576 Takifugu rubripes 66.42 2.00e-54 202.00
IUUC-Tsy-119000 Tarsius syrichta 67.16 6.00e-55 204.00
IUUC-Tni-119745 Tetraodon nigroviridis 66.42 2.00e-54 202.00
IUUC-Tca-121827 Theobroma cacao 64.96 2.00e-54 202.00
IUUC-Tre-122002 Trichoderma reesei 94.81 5.00e-76 274.00
IUUC-Tvi-122331 Trichoderma virens 94.81 5.00e-76 274.00
IUUC-Tae-125400 Triticum aestivum 63.50 2.00e-53 199.00
IUUC-Tur-126866 Triticum urartu 63.50 1.00e-53 199.00
IUUC-Tme-127148 Tuber melanosporum 94.85 2.00e-76 275.00
IUUC-Tbe-127921 Tupaia belangeri 64.93 1.00e-50 189.00
IUUC-Ttr-129121 Tursiops truncatus 67.16 6.00e-55 204.00
IUUC-Uma-129561 Ustilago maydis 72.66 1.00e-55 206.00
IUUC-Vda-129711 Verticillium dahliae 96.30 1.00e-76 276.00
IUUC-Vpa-130570 Vicugna pacos 61.94 2.00e-49 186.00
IUUC-Vvi-131108 Vitis vinifera 64.23 1.00e-54 203.00
IUUC-Xtr-132301 Xenopus tropicalis 67.16 6.00e-55 204.00
IUUC-Xma-133667 Xiphophorus maculatus 67.16 2.00e-55 205.00
IUUC-Yli-134660 Yarrowia lipolytica 82.84 4.00e-67 244.00
IUUC-Zma-135584 Zea mays 62.77 3.00e-53 199.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved