• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Pgr-103611
Ensembl Protein ID EHS63125
UniProt Accession H6QP11; H6QP11_PUCGT
Genbank Protein ID EHS63125.1
Protein Name Ubiquitin-conjugating enzyme E2 2
Genbank Nucleotide ID DS178263
Gene Name PGTG_20712
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
PGTG_20712 EHS63125 EHS63125
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 6.80e-50 168.1 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl +++k+l++dpp gis p + +++ w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP+vkfl+k+fhPnvy+nG++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLIRDFKRLSSDPPGGISGAPCPD-NIMIWNAVIFGPADTPFEDGTFRLILTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQ--NRWSPTYDVAAI 105
    899*********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+s+qsll++pnp+sp+n+eaa+l+++n ++y kkvr
   Q: 106 LTSVQSLLHDPNPNSPANAEAANLYRDNMKDYIKKVR 142
    ***********************************98 PP
   

Organism Puccinia graminis
Protein Sequence
(Fasta)
MSTASRRRLI RDFKRLSSDP PGGISGAPCP DNIMIWNAVI FGPADTPFED GTFRLILTFD 60
ESYPNKPPTV KFLSKMFHPN VYANGELCLD ILQNRWSPTY DVAAILTSVQ SLLHDPNPNS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pgr-103611|E2,E2/UBC|Puccinia graminis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGGGCACCCG GCAACCAACC ACTCCATCGA TCCAACAACC GAAAACACTT CATCTCACAA 60
CCATCATCAA CACCATCATC AGCCTACATA TAAATCGCAC AAGATCACCA AGAAGGATAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pgr-103611|E2,E2/UBC|Puccinia graminis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006281--P:DNA repair
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0016574--P:histone ubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070534--P:protein K63-linked ubiquitination
GO:0000209--P:protein polyubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG pgr:PGTG_20712
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 69.80 3.00e-63 232.00
IUUC-Aml-002120 Ailuropoda melanoleuca 72.19 9.00e-67 243.00
IUUC-Atr-002862 Amborella trichopoda 69.13 7.00e-63 230.00
IUUC-Apl-004063 Anas platyrhynchos 66.22 4.00e-57 211.00
IUUC-Aca-005001 Anolis carolinensis 72.85 6.00e-67 244.00
IUUC-Aly-005584 Arabidopsis lyrata 69.13 1.00e-62 229.00
IUUC-Ath-007149 Arabidopsis thaliana 69.13 1.00e-62 229.00
IUUC-Ago-007745 Ashbya gossypii 71.81 4.00e-67 244.00
IUUC-Acl-008139 Aspergillus clavatus 74.83 3.00e-70 254.00
IUUC-Afl-008551 Aspergillus flavus 74.83 2.00e-70 255.00
IUUC-Afu-008980 Aspergillus fumigatus 74.83 2.00e-70 255.00
IUUC-Ang-009554 Aspergillus niger 74.83 2.00e-70 255.00
IUUC-Aor-010242 Aspergillus oryzae 74.83 2.00e-70 255.00
IUUC-Ate-010390 Aspergillus terreus 74.83 2.00e-70 255.00
IUUC-Ame-010743 Astyanax mexicanus 71.52 7.00e-68 247.00
IUUC-Bgr-012039 Blumeria graminis 72.79 2.00e-62 228.00
IUUC-Bta-012840 Bos taurus 72.19 9.00e-67 243.00
IUUC-Bci-013919 Botrytis cinerea 74.83 3.00e-71 258.00
IUUC-Bdi-014475 Brachypodium distachyon 71.81 1.00e-63 233.00
IUUC-Bol-016245 Brassica oleracea 70.47 3.00e-63 232.00
IUUC-Bra-018026 Brassica rapa 70.47 3.00e-63 232.00
IUUC-Cel-018244 Caenorhabditis elegans 69.18 4.00e-67 245.00
IUUC-Cja-019737 Callithrix jacchus 72.19 9.00e-67 243.00
IUUC-Cfa-020244 Canis familiaris 72.19 9.00e-67 243.00
IUUC-Cpo-022192 Cavia porcellus 72.19 9.00e-67 243.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.76 1.00e-56 209.00
IUUC-Csa-023430 Chlorocebus sabaeus 72.19 9.00e-67 243.00
IUUC-Cho-024773 Choloepus hoffmanni 56.29 3.00e-46 175.00
IUUC-Cin-025537 Ciona intestinalis 68.18 2.00e-52 196.00
IUUC-Csv-025846 Ciona savignyi 69.13 2.00e-55 206.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 75.50 1.00e-71 259.00
IUUC-Cne-026864 Cryptococcus neoformans 77.18 5.00e-70 254.00
IUUC-Cme-027284 Cyanidioschyzon merolae 63.58 1.00e-48 184.00
IUUC-Dre-027775 Danio rerio 71.52 3.00e-68 248.00
IUUC-Dno-029661 Dasypus novemcinctus 72.19 9.00e-67 243.00
IUUC-Dor-030452 Dipodomys ordii 71.32 4.00e-59 218.00
IUUC-Dse-031487 Dothistroma septosporum 74.17 1.00e-69 253.00
IUUC-Dme-031863 Drosophila melanogaster 73.51 4.00e-67 244.00
IUUC-Ete-032595 Echinops telfairi 71.14 2.00e-65 239.00
IUUC-Eca-033377 Equus caballus 72.19 9.00e-67 243.00
IUUC-Eeu-035191 Erinaceus europaeus 56.21 4.00e-46 175.00
IUUC-Fca-036336 Felis catus 72.19 9.00e-67 243.00
IUUC-Fal-037474 Ficedula albicollis 72.03 6.00e-52 193.00
IUUC-Fox-037808 Fusarium oxysporum 75.50 1.00e-71 259.00
IUUC-Fso-038232 Fusarium solani 75.50 2.00e-71 259.00
IUUC-Gmo-038517 Gadus morhua 71.52 9.00e-67 243.00
IUUC-Ggr-039875 Gaeumannomyces graminis 75.84 5.00e-71 258.00
IUUC-Gga-040494 Gallus gallus 72.19 9.00e-67 243.00
IUUC-Gac-042471 Gasterosteus aculeatus 72.19 6.00e-67 244.00
IUUC-Gma-043865 Glycine max 69.80 2.00e-63 232.00
IUUC-Ggo-044896 Gorilla gorilla 71.52 9.00e-67 243.00
IUUC-Hsa-046239 Homo sapiens 72.19 9.00e-67 243.00
IUUC-Hvu-047054 Hordeum vulgare 69.80 3.00e-63 232.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 72.19 9.00e-67 243.00
IUUC-Kpa-049225 Komagataella pastoris 73.15 8.00e-68 247.00
IUUC-Lch-050283 Latimeria chalumnae 72.19 5.00e-67 244.00
IUUC-Lpe-051301 Leersia perrieri 70.47 3.00e-63 232.00
IUUC-Loc-051962 Lepisosteus oculatus 71.52 3.00e-67 245.00
IUUC-Laf-053380 Loxodonta africana 72.19 9.00e-67 243.00
IUUC-Mcc-054819 Macaca mulatta 72.19 4.00e-67 245.00
IUUC-Meu-056231 Macropus eugenii 71.52 9.00e-67 243.00
IUUC-Mor-057087 Magnaporthe oryzae 75.37 7.00e-63 230.00
IUUC-Mpo-057498 Magnaporthe poae 75.84 4.00e-71 258.00
IUUC-Mtr-058305 Medicago truncatula 69.13 6.00e-63 231.00
IUUC-Mla-058876 Melampsora laricipopulina 98.68 6.00e-80 287.00
IUUC-Mga-059863 Meleagris gallopavo 71.53 8.00e-60 220.00
IUUC-Mvi-060330 Microbotryum violaceum 83.87 1.00e-69 253.00
IUUC-Mmr-060630 Microcebus murinus 72.19 9.00e-67 243.00
IUUC-Mdo-062676 Monodelphis domestica 72.19 9.00e-67 243.00
IUUC-Mmu-063491 Mus musculus 72.19 9.00e-67 243.00
IUUC-Mac-065428 Musa acuminata 69.13 7.00e-63 231.00
IUUC-Mpu-065803 Mustela putorius furo 72.19 9.00e-67 243.00
IUUC-Mlu-067147 Myotis lucifugus 72.19 9.00e-67 243.00
IUUC-Nfi-068580 Neosartorya fischeri 74.83 2.00e-70 255.00
IUUC-Ncr-068913 Neurospora crassa 75.50 3.00e-71 258.00
IUUC-Nle-070105 Nomascus leucogenys 72.19 9.00e-67 243.00
IUUC-Opr-070935 Ochotona princeps 72.19 9.00e-67 243.00
IUUC-Ont-071335 Oreochromis niloticus 72.19 2.00e-67 245.00
IUUC-Oan-072706 Ornithorhynchus anatinus 67.81 4.00e-60 221.00
IUUC-Ocu-074130 Oryctolagus cuniculus 72.19 9.00e-67 243.00
IUUC-Oba-075847 Oryza barthii 70.47 1.00e-62 231.00
IUUC-Obr-076713 Oryza brachyantha 70.47 3.00e-63 232.00
IUUC-Ogl-076956 Oryza glaberrima 70.47 4.00e-63 231.00
IUUC-Ogu-078696 Oryza glumaepatula 70.47 3.00e-63 232.00
IUUC-Oin-080106 Oryza indica 70.47 4.00e-63 231.00
IUUC-Olo-081018 Oryza longistaminata 60.00 8.00e-54 201.00
IUUC-Ome-081285 Oryza meridionalis 70.47 3.00e-63 232.00
IUUC-Oni-082088 Oryza nivara 70.47 3.00e-63 232.00
IUUC-Opu-083310 Oryza punctata 70.47 3.00e-63 232.00
IUUC-Oru-084449 Oryza rufipogon 70.47 3.00e-63 232.00
IUUC-Osa-086191 Oryza sativa 70.47 4.00e-63 231.00
IUUC-Ola-087160 Oryzias latipes 72.19 2.00e-67 245.00
IUUC-Olu-087830 Ostreococcus lucimarinus 67.79 7.00e-52 194.00
IUUC-Oga-088836 Otolemur garnettii 72.19 9.00e-67 243.00
IUUC-Oar-090141 Ovis aries 72.19 9.00e-67 243.00
IUUC-Ptr-091453 Pan troglodytes 72.19 9.00e-67 243.00
IUUC-Pan-092511 Papio anubis 72.19 9.00e-67 243.00
IUUC-Psi-093968 Pelodiscus sinensis 72.85 6.00e-67 244.00
IUUC-Pma-094376 Petromyzon marinus 73.51 3.00e-67 245.00
IUUC-Pno-094935 Phaeosphaeria nodorum 73.51 1.00e-69 253.00
IUUC-Ppa-095689 Physcomitrella patens 76.38 7.00e-57 210.00
IUUC-Pfo-096784 Poecilia formosa 71.52 1.00e-67 246.00
IUUC-Pab-098121 Pongo abelii 72.19 9.00e-67 243.00
IUUC-Pop-099517 Populus trichocarpa 69.13 8.00e-63 230.00
IUUC-Pca-100906 Procavia capensis 66.23 3.00e-60 221.00
IUUC-Ppe-101594 Prunus persica 69.13 8.00e-63 230.00
IUUC-Pva-102380 Pteropus vampyrus 70.86 9.00e-65 236.00
IUUC-Ptt-103971 Puccinia triticina 94.70 5.00e-65 237.00
IUUC-Pte-104378 Pyrenophora teres 74.17 5.00e-70 254.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 74.17 5.00e-70 254.00
IUUC-Rno-105772 Rattus norvegicus 72.19 5.00e-67 244.00
IUUC-Sce-106283 Saccharomyces cerevisiae 71.81 4.00e-67 245.00
IUUC-Sha-107650 Sarcophilus harrisii 71.52 2.00e-65 239.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 76.51 5.00e-63 231.00
IUUC-Spo-108073 Schizosaccharomyces pombe 75.84 6.00e-63 231.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 74.83 3.00e-71 258.00
IUUC-Smo-109512 Selaginella moellendorffii 71.81 4.00e-64 234.00
IUUC-Sit-110731 Setaria italica 70.47 3.00e-63 232.00
IUUC-Sly-111217 Solanum lycopersicum 69.80 4.00e-63 231.00
IUUC-Stu-112618 Solanum tuberosum 70.47 1.00e-63 233.00
IUUC-Sar-113429 Sorex araneus 72.19 9.00e-67 243.00
IUUC-Sbi-114788 Sorghum bicolor 69.80 3.00e-63 232.00
IUUC-Sre-115106 Sporisorium reilianum 87.18 1.00e-75 273.00
IUUC-Ssc-116265 Sus scrofa 71.52 9.00e-67 243.00
IUUC-Tgu-117383 Taeniopygia guttata 71.52 9.00e-67 243.00
IUUC-Tru-118576 Takifugu rubripes 70.86 3.00e-67 245.00
IUUC-Tsy-119000 Tarsius syrichta 72.19 9.00e-67 243.00
IUUC-Tni-119745 Tetraodon nigroviridis 70.86 9.00e-67 243.00
IUUC-Tca-121827 Theobroma cacao 69.13 6.00e-63 231.00
IUUC-Tre-122002 Trichoderma reesei 75.50 2.00e-71 258.00
IUUC-Tvi-122331 Trichoderma virens 75.50 2.00e-71 258.00
IUUC-Tae-124461 Triticum aestivum 69.80 4.00e-63 232.00
IUUC-Tur-126866 Triticum urartu 70.47 3.00e-63 231.00
IUUC-Tme-127148 Tuber melanosporum 73.83 8.00e-70 253.00
IUUC-Tbe-127921 Tupaia belangeri 70.20 2.00e-62 229.00
IUUC-Ttr-129121 Tursiops truncatus 72.19 9.00e-67 243.00
IUUC-Uma-129561 Ustilago maydis 87.18 8.00e-76 274.00
IUUC-Vda-129711 Verticillium dahliae 75.50 1.00e-71 259.00
IUUC-Vpa-130570 Vicugna pacos 66.18 2.00e-53 199.00
IUUC-Vvi-131108 Vitis vinifera 69.13 5.00e-63 231.00
IUUC-Xtr-131824 Xenopus tropicalis 71.52 5.00e-67 244.00
IUUC-Xma-133667 Xiphophorus maculatus 72.19 2.00e-67 245.00
IUUC-Yli-134660 Yarrowia lipolytica 72.85 3.00e-68 248.00
IUUC-Zma-135584 Zea mays 69.80 4.00e-63 231.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved