• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Yli-134660
Ensembl Protein ID CAG78731
UniProt Accession Q6C093; UBC2_YARLI
Genbank Protein ID CAG78731.1
Protein Name Ubiquitin-conjugating enzyme E2 2; E2 ubiquitin-conjugating enzyme 2; Ubiquitin carrier protein UBC2; Ubiquitin-protein ligase UBC2
Genbank Nucleotide ID CR382132
Gene Name UBC2; YALI0F26697g
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
YALI0_F26697g CAG78731 CAG78731
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.40e-51 172.4 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++dpp+g+sa+pv + ++ +w+++i+Gp++tp+e+g+F++ ++f+e+YP kPP vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLMRDFKRMQQDPPQGVSASPVAD-NVLTWNAVIIGPAETPFEDGTFRMVLQFDEQYPNKPPAVKFVSQMFHPNVYSSGELCLDILQ--NRWSPTYDVAAI 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+s+qsll++pn++sp+n+ea+ l+k++r++y+k+vr
   Q: 106 LTSVQSLLNDPNTSSPANVEASMLYKDHRQQYEKRVR 142
    ***********************************98 PP
   

Organism Yarrowia lipolytica
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Protein Sequence
(Fasta)
MSTTARRRLM RDFKRMQQDP PQGVSASPVA DNVLTWNAVI IGPAETPFED GTFRMVLQFD 60
EQYPNKPPAV KFVSQMFHPN VYSSGELCLD ILQNRWSPTY DVAAILTSVQ SLLNDPNTSS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Yli-134660|E2,E2/UBC|Yarrowia lipolytica
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCCACTA CAGCTCGAAG ACGTCTCATG CGAGACTTCA AGCGCATGCA ACAGGATCCT 60
CCCCAGGGAG TCAGTGCATC TCCTGTGGCT GATAACGTGC TGACATGGAA CGCCGTGATC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Yli-134660|E2,E2/UBC|Yarrowia lipolytica
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0156--Chromatin regulator
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0227--DNA damage
KW-0234--DNA repair
KW-0547--Nucleotide-binding
KW-0539--Nucleus
KW-1185--Reference proteome
KW-0749--Sporulation
KW-0804--Transcription
KW-0805--Transcription regulation
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006281--P:DNA repair
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0016574--P:histone ubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070534--P:protein K63-linked ubiquitination
GO:0000209--P:protein polyubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0030435--P:sporulation resulting in formation of a cellular spore
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG yli:YALI0F26697g
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 60.67 3.00e-59 218.00
IUUC-Aml-002120 Ailuropoda melanoleuca 66.23 2.00e-63 232.00
IUUC-Atr-002623 Amborella trichopoda 64.00 3.00e-60 221.00
IUUC-Apl-004063 Anas platyrhynchos 58.78 4.00e-53 197.00
IUUC-Aca-005001 Anolis carolinensis 65.56 2.00e-63 232.00
IUUC-Aly-005584 Arabidopsis lyrata 65.33 4.00e-61 224.00
IUUC-Ath-007149 Arabidopsis thaliana 65.33 4.00e-61 224.00
IUUC-Ago-007745 Ashbya gossypii 75.17 3.00e-70 255.00
IUUC-Acl-008139 Aspergillus clavatus 85.43 4.00e-78 280.00
IUUC-Afl-008551 Aspergillus flavus 85.43 4.00e-78 281.00
IUUC-Afu-008980 Aspergillus fumigatus 85.43 4.00e-78 281.00
IUUC-Ang-009554 Aspergillus niger 85.43 4.00e-78 281.00
IUUC-Aor-010242 Aspergillus oryzae 85.43 4.00e-78 281.00
IUUC-Ate-010390 Aspergillus terreus 85.43 4.00e-78 281.00
IUUC-Ame-010743 Astyanax mexicanus 66.23 6.00e-64 234.00
IUUC-Bgr-012039 Blumeria graminis 84.56 1.00e-69 252.00
IUUC-Bta-012840 Bos taurus 66.23 2.00e-63 232.00
IUUC-Bci-013919 Botrytis cinerea 84.11 4.00e-77 277.00
IUUC-Bdi-014475 Brachypodium distachyon 63.33 1.00e-59 219.00
IUUC-Bol-015726 Brassica oleracea 65.33 8.00e-61 226.00
IUUC-Bra-016809 Brassica rapa 65.33 4.00e-61 225.00
IUUC-Cel-018244 Caenorhabditis elegans 68.46 9.00e-65 237.00
IUUC-Cja-019737 Callithrix jacchus 66.23 2.00e-63 232.00
IUUC-Cfa-020244 Canis familiaris 66.23 2.00e-63 232.00
IUUC-Cpo-022192 Cavia porcellus 66.23 2.00e-63 232.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 62.25 1.00e-51 193.00
IUUC-Csa-023430 Chlorocebus sabaeus 66.23 2.00e-63 232.00
IUUC-Cho-024773 Choloepus hoffmanni 52.32 2.00e-43 166.00
IUUC-Cin-025537 Ciona intestinalis 66.23 3.00e-53 198.00
IUUC-Csv-025846 Ciona savignyi 65.77 3.00e-56 208.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 84.77 7.00e-78 280.00
IUUC-Cne-026864 Cryptococcus neoformans 69.13 1.00e-64 236.00
IUUC-Cme-027284 Cyanidioschyzon merolae 60.67 8.00e-49 184.00
IUUC-Dre-027775 Danio rerio 66.89 3.00e-64 234.00
IUUC-Dno-029661 Dasypus novemcinctus 66.23 2.00e-63 232.00
IUUC-Dor-030452 Dipodomys ordii 63.24 5.00e-55 204.00
IUUC-Dse-031487 Dothistroma septosporum 84.11 1.00e-77 279.00
IUUC-Dme-031863 Drosophila melanogaster 67.55 9.00e-64 233.00
IUUC-Ete-032595 Echinops telfairi 64.90 2.00e-62 228.00
IUUC-Eca-033377 Equus caballus 66.23 2.00e-63 232.00
IUUC-Eeu-035191 Erinaceus europaeus 52.29 1.00e-42 163.00
IUUC-Fca-036336 Felis catus 66.23 2.00e-63 232.00
IUUC-Fal-037474 Ficedula albicollis 65.25 3.00e-48 181.00
IUUC-Fox-037808 Fusarium oxysporum 84.11 3.00e-77 278.00
IUUC-Fso-038232 Fusarium solani 83.44 7.00e-77 276.00
IUUC-Gmo-038517 Gadus morhua 66.23 2.00e-63 231.00
IUUC-Ggr-039875 Gaeumannomyces graminis 83.89 3.00e-76 274.00
IUUC-Gga-040494 Gallus gallus 66.23 2.00e-63 232.00
IUUC-Gac-042471 Gasterosteus aculeatus 66.23 1.00e-63 233.00
IUUC-Gma-043688 Glycine max 65.33 6.00e-61 223.00
IUUC-Ggo-044896 Gorilla gorilla 66.23 2.00e-63 231.00
IUUC-Hsa-046239 Homo sapiens 66.23 2.00e-63 232.00
IUUC-Hvu-047054 Hordeum vulgare 60.67 3.00e-59 218.00
IUUC-Itr-048960 Ictidomys tridecemlineatus 66.23 2.00e-63 232.00
IUUC-Kpa-049225 Komagataella pastoris 81.33 1.00e-74 269.00
IUUC-Lch-050283 Latimeria chalumnae 66.23 9.00e-64 233.00
IUUC-Lpe-051301 Leersia perrieri 64.00 2.00e-60 221.00
IUUC-Loc-051962 Lepisosteus oculatus 66.23 6.00e-64 233.00
IUUC-Laf-053380 Loxodonta africana 66.23 2.00e-63 232.00
IUUC-Mcc-054819 Macaca mulatta 66.23 1.00e-63 233.00
IUUC-Meu-056231 Macropus eugenii 66.23 2.00e-63 231.00
IUUC-Mor-057087 Magnaporthe oryzae 82.84 3.00e-67 244.00
IUUC-Mpo-057498 Magnaporthe poae 83.89 3.00e-76 275.00
IUUC-Mtr-058305 Medicago truncatula 64.00 2.00e-60 222.00
IUUC-Mla-058876 Melampsora laricipopulina 72.85 3.00e-62 228.00
IUUC-Mga-059863 Meleagris gallopavo 62.59 9.00e-56 206.00
IUUC-Mvi-060330 Microbotryum violaceum 76.16 2.00e-62 228.00
IUUC-Mmr-060630 Microcebus murinus 66.23 2.00e-63 232.00
IUUC-Mdo-062676 Monodelphis domestica 66.23 2.00e-63 232.00
IUUC-Mmu-063491 Mus musculus 66.23 2.00e-63 232.00
IUUC-Mac-064774 Musa acuminata 65.33 8.00e-61 223.00
IUUC-Mpu-065803 Mustela putorius furo 66.23 2.00e-63 232.00
IUUC-Mlu-067147 Myotis lucifugus 66.23 2.00e-63 232.00
IUUC-Nfi-068580 Neosartorya fischeri 85.43 4.00e-78 281.00
IUUC-Ncr-068913 Neurospora crassa 82.78 9.00e-77 276.00
IUUC-Nle-070105 Nomascus leucogenys 66.23 2.00e-63 232.00
IUUC-Opr-070935 Ochotona princeps 66.23 2.00e-63 232.00
IUUC-Ont-071335 Oreochromis niloticus 66.23 1.00e-63 233.00
IUUC-Oan-072706 Ornithorhynchus anatinus 60.96 2.00e-56 209.00
IUUC-Ocu-074130 Oryctolagus cuniculus 66.23 2.00e-63 232.00
IUUC-Oba-075896 Oryza barthii 64.00 2.00e-60 221.00
IUUC-Obr-076770 Oryza brachyantha 64.67 1.00e-60 223.00
IUUC-Ogl-077116 Oryza glaberrima 64.00 2.00e-60 221.00
IUUC-Ogu-078696 Oryza glumaepatula 64.00 2.00e-60 221.00
IUUC-Oin-079099 Oryza indica 64.00 2.00e-60 221.00
IUUC-Olo-081018 Oryza longistaminata 53.94 2.00e-50 189.00
IUUC-Ome-081285 Oryza meridionalis 64.00 2.00e-60 221.00
IUUC-Oni-082088 Oryza nivara 64.00 2.00e-60 221.00
IUUC-Opu-083310 Oryza punctata 64.00 2.00e-60 221.00
IUUC-Oru-084449 Oryza rufipogon 64.00 2.00e-60 221.00
IUUC-Osa-085923 Oryza sativa 64.00 2.00e-60 221.00
IUUC-Ola-087160 Oryzias latipes 66.23 1.00e-63 233.00
IUUC-Olu-087830 Ostreococcus lucimarinus 63.09 4.00e-52 194.00
IUUC-Oga-088836 Otolemur garnettii 66.23 2.00e-63 232.00
IUUC-Oar-090141 Ovis aries 66.23 2.00e-63 232.00
IUUC-Ptr-091453 Pan troglodytes 66.23 2.00e-63 232.00
IUUC-Pan-092511 Papio anubis 66.23 2.00e-63 232.00
IUUC-Psi-093968 Pelodiscus sinensis 65.56 2.00e-63 232.00
IUUC-Pma-094376 Petromyzon marinus 66.89 4.00e-63 231.00
IUUC-Pno-094935 Phaeosphaeria nodorum 82.12 4.00e-76 274.00
IUUC-Ppa-095689 Physcomitrella patens 64.00 2.00e-52 195.00
IUUC-Pfo-096784 Poecilia formosa 66.23 1.00e-63 233.00
IUUC-Pab-098121 Pongo abelii 66.23 2.00e-63 232.00
IUUC-Pop-099517 Populus trichocarpa 64.00 2.00e-60 222.00
IUUC-Pca-100906 Procavia capensis 60.93 1.00e-56 209.00
IUUC-Ppe-101594 Prunus persica 64.00 2.00e-60 222.00
IUUC-Pva-102380 Pteropus vampyrus 65.56 2.00e-61 225.00
IUUC-Pgr-103611 Puccinia graminis 72.85 2.00e-62 229.00
IUUC-Ptt-103971 Puccinia triticina 76.27 2.00e-48 182.00
IUUC-Pte-104378 Pyrenophora teres 83.44 5.00e-77 277.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 83.44 5.00e-77 277.00
IUUC-Rno-105772 Rattus norvegicus 66.23 1.00e-63 233.00
IUUC-Sce-106283 Saccharomyces cerevisiae 75.17 2.00e-70 255.00
IUUC-Sha-107650 Sarcophilus harrisii 65.56 3.00e-62 228.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 80.54 3.00e-65 238.00
IUUC-Spo-108073 Schizosaccharomyces pombe 80.54 3.00e-65 238.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 84.11 4.00e-77 277.00
IUUC-Smo-109036 Selaginella moellendorffii 64.67 6.00e-61 223.00
IUUC-Sit-110731 Setaria italica 64.00 2.00e-60 221.00
IUUC-Sly-111506 Solanum lycopersicum 64.00 2.00e-60 222.00
IUUC-Stu-112518 Solanum tuberosum 63.33 2.00e-60 223.00
IUUC-Sar-113429 Sorex araneus 66.23 2.00e-63 232.00
IUUC-Sbi-114289 Sorghum bicolor 64.00 2.00e-60 221.00
IUUC-Sre-115106 Sporisorium reilianum 70.20 1.00e-60 223.00
IUUC-Ssc-116265 Sus scrofa 66.23 2.00e-63 231.00
IUUC-Tgu-117383 Taeniopygia guttata 66.23 2.00e-63 231.00
IUUC-Tru-118576 Takifugu rubripes 66.23 1.00e-63 233.00
IUUC-Tsy-119000 Tarsius syrichta 66.23 2.00e-63 232.00
IUUC-Tni-119745 Tetraodon nigroviridis 66.23 1.00e-63 233.00
IUUC-Tca-121827 Theobroma cacao 63.33 3.00e-60 221.00
IUUC-Tre-122002 Trichoderma reesei 83.44 7.00e-77 276.00
IUUC-Tvi-122331 Trichoderma virens 83.44 7.00e-77 276.00
IUUC-Tae-124461 Triticum aestivum 64.00 2.00e-60 223.00
IUUC-Tur-126866 Triticum urartu 62.00 3.00e-59 218.00
IUUC-Tme-127148 Tuber melanosporum 83.22 2.00e-76 275.00
IUUC-Tbe-127921 Tupaia belangeri 64.24 4.00e-59 218.00
IUUC-Ttr-129121 Tursiops truncatus 66.23 2.00e-63 232.00
IUUC-Uma-129561 Ustilago maydis 70.20 9.00e-61 223.00
IUUC-Vda-129711 Verticillium dahliae 84.77 7.00e-78 280.00
IUUC-Vpa-130570 Vicugna pacos 58.09 3.00e-49 184.00
IUUC-Vvi-131108 Vitis vinifera 64.00 8.00e-61 223.00
IUUC-Xtr-131824 Xenopus tropicalis 66.89 5.00e-64 234.00
IUUC-Xma-133667 Xiphophorus maculatus 66.23 1.00e-63 233.00
IUUC-Zma-135584 Zea mays 62.67 7.00e-60 220.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved