• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bdi-014592
UUCD1 version UUC-BrD-01544
Ensembl Protein ID BRADI1G03800.1
UniProt Accession I1GLK5; I1GLK5_BRADI
Genbank Protein ID KQK12445.1
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Genbank Nucleotide ID CM000880
Gene Name LOC100827652; BRADI_1g03800
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
BRADI1G03800 BRADI1G03800.1 BRADI1G03800.1
BRADI1G03800 BRADI1G03800.2 BRADI1G03800.2
Status Unreviewed
Classification
Family E-Value Score Start End
E1 1.80e-107 360.7 15 521
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvnveahee 95
    YDRQ+r+wG+++q++l++a+++l++ g++G+E lKnLvl+G+gs+tvvD+++ve s+l+++FL+++e g+s+A++++ +l+eln+ v+v+ +ee
   Q: 15 YDRQLRIWGDQGQAALEKASICLLNSGPTGTEALKNLVLGGIGSVTVVDGSKVEPSDLGNNFLLNKECLGQSRAQSVCSFLQELNDAVKVKYVEE 109
    *********************************************************************************************** PP
   S: 96 siteleeeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfctlketpn..... 181
    s+ + ++++ Ff++f+vV++++ ++++ +k++ +c++a++ l+ ++++Gl G vrv++k++ +++s++d d++++ +P+ +lk++
   Q: 110 SPGTMIDTNPsFFSQFTVVIATQLPESSLLKLDGICRAADIVLVAARSYGLTGLVRVSVKEHCVIESKPDhflDDLRLHNPWTELKQFAKsidic 204
    ****************************************************************************************9999999 PP
   S: 182 ....aaehtiewavlfnklleeeageeevlekldseekeegkdkvkselksedeenfeeaieiavkafakttins.ikqllksfecdivtksksp 271
    +++++++++v++ l+e++a +++++ +++++ek+e+kd++++ + + deen++ea+e + k + i+ i+q++++ + +v+ s+s+
   Q: 205 dkdpVVHKHTPYIVILVRLAEKWADAHDGKLPSTRQEKREFKDLIRAHMLNVDEENYKEAVESSYKVSVTPGISTeIRQIIDD-SSSEVNLSSSD 298
    9999*******************************************************************************.55599****** PP
   S: 272 fwv...........................................................................sfcsnaealq....... 284
    fwv +fc+na++l+
   Q: 299 FWVlvaalkefianegngdlplegtipdmtsqteyyvslqkiyqakaetdclamehrvknilkrigrhpdsisrayikTFCKNARKLRvcryrsm 393
    ****************************************************************************************6666666 PP
   S: 285 ....vpekvekdeevvkasap.....lylllralerfekkkgrkpgelsfekdddsavdlvtaaanlraeslgiep.kldddlikeiagniipai 369
    + + + +++++++++ +y+llra++r++++++r pg ++ e d+d +++l+ aa + +++g+++ l++dl++e+++++ ++i
   Q: 394 eeefNAPVISEVQKYFADEDScfamnFYILLRAVDRLAANYSRLPGIFDSEIDED-VPRLKVAAVSVL-SDMGLNGtSLSEDLVTEVCRFAGAEI 486
    55543355566666666666678888********************999999999.****99999887.************************** PP
   S: 370 attnavvgGlaaqEviKvvsgkfeplknfflfdae 404
    ++++a++gG+a+qEviK+v+++f+pl +f+f+++
   Q: 487 HPVAAFIGGVASQEVIKLVTKQFVPLMGTFIFNGI 521
    ********************************986 PP
   

Organism Brachypodium distachyon
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Protein Sequence
(Fasta)
MAAAAVAVAE PKTKYDRQLR IWGDQGQAAL EKASICLLNS GPTGTEALKN LVLGGIGSVT 60
VVDGSKVEPS DLGNNFLLNK ECLGQSRAQS VCSFLQELND AVKVKYVEES PGTMIDTNPS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bdi-014592|E1,E1_ThiF|Brachypodium distachyon
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGTTCCAGTC CTTCACTTCG GCTTCCGCTT TATTCTTCGC CGGAGAGGAA CACGAAACCC 60
CATGGCCGCC GCCGCAGTCG CCGTAGCCGA GCCTAAGACC AAGTACGATC GCCAGCTCAG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bdi-014592|E1,E1_ThiF|Brachypodium distachyon
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

KEGG bdi:100827652
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 90.87 0.00e+00 959.00
IUUC-Aml-002333 Ailuropoda melanoleuca 43.54 1.00e-129 456.00
IUUC-Atr-002644 Amborella trichopoda 68.71 0.00e+00 729.00
IUUC-Apl-003446 Anas platyrhynchos 43.30 9.00e-120 422.00
IUUC-Aca-004450 Anolis carolinensis 42.21 8.00e-126 443.00
IUUC-Aly-005466 Arabidopsis lyrata 65.33 0.00e+00 738.00
IUUC-Ath-006692 Arabidopsis thaliana 66.09 0.00e+00 739.00
IUUC-Ago-007900 Ashbya gossypii 26.96 4.00e-40 158.00
IUUC-Acl-008333 Aspergillus clavatus 33.64 2.00e-70 259.00
IUUC-Afl-008529 Aspergillus flavus 33.58 9.00e-76 276.00
IUUC-Afu-009071 Aspergillus fumigatus 33.70 7.00e-71 260.00
IUUC-Ani-009443 Aspergillus nidulans 32.60 4.00e-63 234.00
IUUC-Ang-009669 Aspergillus niger 32.79 9.00e-73 266.00
IUUC-Aor-009914 Aspergillus oryzae 33.27 1.00e-73 270.00
IUUC-Ate-010450 Aspergillus terreus 32.37 1.00e-71 263.00
IUUC-Ame-011183 Astyanax mexicanus 41.51 1.00e-124 439.00
IUUC-Bgr-012111 Blumeria graminis 33.89 4.00e-64 238.00
IUUC-Bta-012583 Bos taurus 43.70 9.00e-131 459.00
IUUC-Bci-013892 Botrytis cinerea 32.78 4.00e-61 228.00
IUUC-Bol-016399 Brassica oleracea 65.83 0.00e+00 743.00
IUUC-Bra-017506 Brassica rapa 65.20 0.00e+00 726.00
IUUC-Cel-018456 Caenorhabditis elegans 30.90 7.00e-70 257.00
IUUC-Cja-020007 Callithrix jacchus 43.64 2.00e-129 454.00
IUUC-Cfa-020324 Canis familiaris 43.70 2.00e-131 462.00
IUUC-Cpo-022248 Cavia porcellus 39.31 4.00e-69 254.00
IUUC-Csa-023149 Chlorocebus sabaeus 40.52 7.00e-102 363.00
IUUC-Cho-024537 Choloepus hoffmanni 35.93 6.00e-87 313.00
IUUC-Cin-025763 Ciona intestinalis 40.94 2.00e-110 391.00
IUUC-Csv-026113 Ciona savignyi 39.78 3.00e-104 371.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 30.91 4.00e-59 221.00
IUUC-Cne-026884 Cryptococcus neoformans 32.70 3.00e-67 248.00
IUUC-Cme-027210 Cyanidioschyzon merolae 25.65 7.00e-16 78.20
IUUC-Dre-028140 Danio rerio 41.95 6.00e-128 450.00
IUUC-Dno-030033 Dasypus novemcinctus 43.48 1.00e-113 402.00
IUUC-Dor-030513 Dipodomys ordii 37.60 1.00e-39 156.00
IUUC-Dse-031536 Dothistroma septosporum 31.53 8.00e-66 243.00
IUUC-Dme-031683 Drosophila melanogaster 37.52 1.00e-96 346.00
IUUC-Ete-032420 Echinops telfairi 38.49 1.00e-109 389.00
IUUC-Eca-033992 Equus caballus 40.77 6.00e-100 356.00
IUUC-Eeu-034713 Erinaceus europaeus 33.19 2.00e-36 146.00
IUUC-Fca-036548 Felis catus 43.32 1.00e-130 459.00
IUUC-Fal-037600 Ficedula albicollis 42.48 1.00e-117 416.00
IUUC-Fox-038037 Fusarium oxysporum 32.42 3.00e-68 252.00
IUUC-Fso-038387 Fusarium solani 32.78 8.00e-69 253.00
IUUC-Gmo-038562 Gadus morhua 41.48 6.00e-122 430.00
IUUC-Ggr-040005 Gaeumannomyces graminis 35.81 2.00e-54 206.00
IUUC-Gga-041129 Gallus gallus 43.16 1.00e-120 426.00
IUUC-Gac-042558 Gasterosteus aculeatus 41.51 5.00e-125 440.00
IUUC-Gma-043610 Glycine max 67.95 0.00e+00 735.00
IUUC-Ggo-045611 Gorilla gorilla 43.26 2.00e-128 452.00
IUUC-Hsa-046563 Homo sapiens 43.51 1.00e-129 455.00
IUUC-Hvu-047790 Hordeum vulgare 91.77 0.00e+00 716.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 43.32 3.00e-129 454.00
IUUC-Kpa-049309 Komagataella pastoris 35.38 2.00e-76 278.00
IUUC-Lch-050038 Latimeria chalumnae 42.88 4.00e-125 440.00
IUUC-Lpe-051535 Leersia perrieri 84.10 0.00e+00 826.00
IUUC-Loc-051917 Lepisosteus oculatus 38.97 1.00e-107 382.00
IUUC-Lma-053112 Leptosphaeria maculans 32.85 4.00e-70 258.00
IUUC-Laf-053690 Loxodonta africana 43.70 1.00e-131 462.00
IUUC-Mcc-055117 Macaca mulatta 43.18 1.00e-126 446.00
IUUC-Meu-056761 Macropus eugenii 36.93 4.00e-96 344.00
IUUC-Mor-057230 Magnaporthe oryzae 32.90 7.00e-67 247.00
IUUC-Mpo-057514 Magnaporthe poae 31.68 3.00e-61 228.00
IUUC-Mtr-058551 Medicago truncatula 65.36 0.00e+00 710.00
IUUC-Mla-059183 Melampsora laricipopulina 35.30 8.00e-86 310.00
IUUC-Mga-060144 Meleagris gallopavo 42.64 5.00e-117 414.00
IUUC-Mvi-060221 Microbotryum violaceum 33.02 7.00e-69 254.00
IUUC-Mmr-061325 Microcebus murinus 43.07 5.00e-127 447.00
IUUC-Mdo-062532 Monodelphis domestica 44.11 1.00e-129 456.00
IUUC-Mmu-063956 Mus musculus 43.13 2.00e-129 454.00
IUUC-Mac-064521 Musa acuminata 73.22 0.00e+00 803.00
IUUC-Mpu-066716 Mustela putorius furo 43.90 5.00e-122 431.00
IUUC-Mlu-067459 Myotis lucifugus 44.00 7.00e-132 463.00
IUUC-Nfi-068245 Neosartorya fischeri 33.27 2.00e-69 255.00
IUUC-Ncr-068910 Neurospora crassa 32.72 8.00e-66 243.00
IUUC-Nle-070034 Nomascus leucogenys 42.12 1.00e-122 432.00
IUUC-Opr-070552 Ochotona princeps 39.35 3.00e-99 354.00
IUUC-Ont-071426 Oreochromis niloticus 42.02 4.00e-127 447.00
IUUC-Oan-073389 Ornithorhynchus anatinus 39.01 5.00e-87 314.00
IUUC-Ocu-074911 Oryctolagus cuniculus 43.70 5.00e-131 460.00
IUUC-Oba-075437 Oryza barthii 88.68 0.00e+00 899.00
IUUC-Obr-076684 Oryza brachyantha 86.71 0.00e+00 837.00
IUUC-Ogl-077170 Oryza glaberrima 88.68 0.00e+00 899.00
IUUC-Ogu-078844 Oryza glumaepatula 87.73 0.00e+00 847.00
IUUC-Oin-079105 Oryza indica 88.68 0.00e+00 898.00
IUUC-Olo-080943 Oryza longistaminata 85.83 0.00e+00 820.00
IUUC-Oni-082891 Oryza nivara 86.18 0.00e+00 870.00
IUUC-Opu-083457 Oryza punctata 88.29 0.00e+00 892.00
IUUC-Oru-084960 Oryza rufipogon 85.83 0.00e+00 822.00
IUUC-Osa-085358 Oryza sativa 88.29 0.00e+00 892.00
IUUC-Ola-086420 Oryzias latipes 39.10 1.00e-78 285.00
IUUC-Olu-087625 Ostreococcus lucimarinus 30.47 2.00e-61 229.00
IUUC-Oga-088810 Otolemur garnettii 43.32 8.00e-130 456.00
IUUC-Oar-089196 Ovis aries 43.26 6.00e-129 453.00
IUUC-Ptr-090617 Pan troglodytes 43.51 9.00e-130 456.00
IUUC-Pan-092761 Papio anubis 43.70 7.00e-131 459.00
IUUC-Psi-093191 Pelodiscus sinensis 40.73 1.00e-121 429.00
IUUC-Pma-094380 Petromyzon marinus 41.85 8.00e-111 393.00
IUUC-Pno-095084 Phaeosphaeria nodorum 32.28 1.00e-61 231.00
IUUC-Ppa-095798 Physcomitrella patens 55.81 2.00e-172 598.00
IUUC-Pfo-096467 Poecilia formosa 42.21 8.00e-124 436.00
IUUC-Pab-098255 Pongo abelii 45.03 2.00e-109 388.00
IUUC-Pop-099722 Populus trichocarpa 68.91 0.00e+00 770.00
IUUC-Pca-100807 Procavia capensis 53.23 9.00e-55 206.00
IUUC-Ppe-101280 Prunus persica 67.95 0.00e+00 758.00
IUUC-Pva-102333 Pteropus vampyrus 42.31 7.00e-124 436.00
IUUC-Pgr-103401 Puccinia graminis 29.96 2.00e-67 249.00
IUUC-Ptt-103889 Puccinia triticina 27.96 2.00e-59 222.00
IUUC-Pte-104355 Pyrenophora teres 33.63 8.00e-69 253.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 33.99 4.00e-69 254.00
IUUC-Rno-105810 Rattus norvegicus 42.75 2.00e-127 448.00
IUUC-Sce-106397 Saccharomyces cerevisiae 27.55 4.00e-32 131.00
IUUC-Sha-106770 Sarcophilus harrisii 50.00 1.00e-72 265.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 33.52 1.00e-78 286.00
IUUC-Spo-108276 Schizosaccharomyces pombe 34.10 6.00e-82 297.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 33.33 1.00e-61 229.00
IUUC-Smo-109296 Selaginella moellendorffii 53.08 2.00e-162 564.00
IUUC-Sit-110157 Setaria italica 87.33 0.00e+00 944.00
IUUC-Sly-111105 Solanum lycopersicum 66.36 0.00e+00 742.00
IUUC-Stu-112469 Solanum tuberosum 66.73 0.00e+00 749.00
IUUC-Sar-113083 Sorex araneus 34.04 3.00e-87 315.00
IUUC-Sbi-113813 Sorghum bicolor 88.29 0.00e+00 952.00
IUUC-Sre-115058 Sporisorium reilianum 31.19 1.00e-70 259.00
IUUC-Tgu-116772 Taeniopygia guttata 42.69 4.00e-117 414.00
IUUC-Tru-118686 Takifugu rubripes 40.75 3.00e-125 441.00
IUUC-Tsy-119111 Tarsius syrichta 45.63 1.00e-63 236.00
IUUC-Tni-120231 Tetraodon nigroviridis 39.77 6.00e-111 393.00
IUUC-Tca-121491 Theobroma cacao 68.33 0.00e+00 723.00
IUUC-Tre-122103 Trichoderma reesei 32.59 4.00e-72 264.00
IUUC-Tvi-122672 Trichoderma virens 33.08 7.00e-69 253.00
IUUC-Tae-125950 Triticum aestivum 91.94 0.00e+00 969.00
IUUC-Tur-126487 Triticum urartu 90.52 0.00e+00 936.00
IUUC-Tme-127097 Tuber melanosporum 34.38 2.00e-78 285.00
IUUC-Ttr-128465 Tursiops truncatus 40.23 1.00e-114 405.00
IUUC-Uma-129645 Ustilago maydis 32.58 3.00e-61 228.00
IUUC-Vda-129989 Verticillium dahliae 29.57 7.00e-50 190.00
IUUC-Vpa-130529 Vicugna pacos 41.18 2.00e-119 421.00
IUUC-Vvi-131059 Vitis vinifera 69.87 0.00e+00 773.00
IUUC-Xtr-132002 Xenopus tropicalis 43.32 6.00e-128 450.00
IUUC-Xma-133930 Xiphophorus maculatus 41.90 8.00e-127 446.00
IUUC-Yli-134505 Yarrowia lipolytica 34.49 2.00e-80 291.00
IUUC-Zma-135895 Zea mays 87.14 0.00e+00 940.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved