• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP

Tag Content
iUUCD ID IUUC-Ago-007745
Ensembl Protein ID AAS50523
UniProt Accession Q75EB8; UBC2_ASHGO
Genbank Protein ID AAS50523.1
Protein Name Ubiquitin-conjugating enzyme E2 2; E2 ubiquitin-conjugating enzyme 2; Ubiquitin carrier protein UBC2; Ubiquitin-protein ligase UBC2
Genbank Nucleotide ID AE016814
Gene Name UBC2; AAR156C
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AGOS_AAR156C AAS50523 AAS50523
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.20e-52 175.3 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++d p+g+sa+p + +++ w+++i+Gp+dtpYe+g+F+l +ef+e+YP kPP+vkfl+++fhPnvy+nG++Cl+il+ ++W+p+++v+s+
   Q: 8 RLMRDFKRMKEDAPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ--NRWTPTYDVASI 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvre 139
    l+siqsl+++pnp+sp+n+eaa+l+k+++++y k+v+e
   Q: 106 LTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKE 143
    ***********************************985 PP
   

Organism Ashbya gossypii
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Protein Sequence
(Fasta)
MSTPARRRLM RDFKRMKEDA PPGVSASPLP DNVMVWNAMI IGPADTPYED GTFRLLLEFD 60
EEYPNKPPHV KFLSEMFHPN VYANGEICLD ILQNRWTPTY DVASILTSIQ SLFNDPNPAS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ago-007745|E2,E2/UBC|Ashbya gossypii
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGAGCACAC CAGCAAGGAG AAGATTGATG AGAGACTTCA AACGGATGAA GGAGGATGCG 60
CCGCCAGGAG TGTCTGCGTC GCCACTACCC GATAACGTGA TGGTATGGAA CGCGATGATT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ago-007745|E2,E2/UBC|Ashbya gossypii
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0156--Chromatin regulator
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0227--DNA damage
KW-0234--DNA repair
KW-0547--Nucleotide-binding
KW-0539--Nucleus
KW-1185--Reference proteome
KW-0749--Sporulation
KW-0804--Transcription
KW-0805--Transcription regulation
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006281--P:DNA repair
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0016574--P:histone ubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070534--P:protein K63-linked ubiquitination
GO:0000209--P:protein polyubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0030435--P:sporulation resulting in formation of a cellular spore
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG ago:AGOS_AAR156C
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 63.76 1.00e-59 219.00
IUUC-Aml-002120 Ailuropoda melanoleuca 69.80 2.00e-63 231.00
IUUC-Atr-002862 Amborella trichopoda 65.10 2.00e-60 222.00
IUUC-Apl-004063 Anas platyrhynchos 61.64 5.00e-52 194.00
IUUC-Aca-005001 Anolis carolinensis 69.80 2.00e-63 232.00
IUUC-Aly-006336 Arabidopsis lyrata 65.10 2.00e-55 205.00
IUUC-Ath-007547 Arabidopsis thaliana 65.10 2.00e-55 205.00
IUUC-Acl-008139 Aspergillus clavatus 76.00 1.00e-70 256.00
IUUC-Afl-008551 Aspergillus flavus 76.67 4.00e-71 257.00
IUUC-Afu-008980 Aspergillus fumigatus 76.67 4.00e-71 257.00
IUUC-Ang-009554 Aspergillus niger 76.67 4.00e-71 257.00
IUUC-Aor-010242 Aspergillus oryzae 76.67 4.00e-71 257.00
IUUC-Ate-010390 Aspergillus terreus 76.67 4.00e-71 257.00
IUUC-Ame-010743 Astyanax mexicanus 69.13 1.00e-63 233.00
IUUC-Bgr-012039 Blumeria graminis 74.07 1.00e-62 229.00
IUUC-Bta-012840 Bos taurus 69.80 2.00e-63 231.00
IUUC-Bci-013919 Botrytis cinerea 76.67 4.00e-71 257.00
IUUC-Bdi-014308 Brachypodium distachyon 65.10 6.00e-60 220.00
IUUC-Bol-016084 Brassica oleracea 64.43 6.00e-60 220.00
IUUC-Bra-016803 Brassica rapa 65.10 2.00e-55 205.00
IUUC-Cel-018244 Caenorhabditis elegans 67.11 2.00e-62 229.00
IUUC-Cja-018783 Callithrix jacchus 69.80 2.00e-63 232.00
IUUC-Cfa-020646 Canis familiaris 69.80 2.00e-63 232.00
IUUC-Cpo-021323 Cavia porcellus 69.80 1.00e-63 232.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 68.99 1.00e-52 196.00
IUUC-Csa-023588 Chlorocebus sabaeus 69.80 2.00e-63 232.00
IUUC-Cho-024773 Choloepus hoffmanni 53.69 3.00e-43 164.00
IUUC-Cin-025537 Ciona intestinalis 68.46 2.00e-52 195.00
IUUC-Csv-025846 Ciona savignyi 68.46 1.00e-55 206.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 77.33 4.00e-72 260.00
IUUC-Cne-026864 Cryptococcus neoformans 71.14 4.00e-65 238.00
IUUC-Cme-027284 Cyanidioschyzon merolae 58.00 2.00e-45 173.00
IUUC-Dre-028358 Danio rerio 69.80 2.00e-63 232.00
IUUC-Dno-029661 Dasypus novemcinctus 69.80 2.00e-63 231.00
IUUC-Dor-030452 Dipodomys ordii 66.42 6.00e-54 200.00
IUUC-Dse-031487 Dothistroma septosporum 76.00 1.00e-70 255.00
IUUC-Dme-031863 Drosophila melanogaster 69.13 1.00e-62 229.00
IUUC-Ete-032595 Echinops telfairi 68.46 3.00e-62 228.00
IUUC-Eca-033377 Equus caballus 69.80 2.00e-63 231.00
IUUC-Eeu-035191 Erinaceus europaeus 54.30 4.00e-43 164.00
IUUC-Fca-036581 Felis catus 69.80 2.00e-63 232.00
IUUC-Fal-037474 Ficedula albicollis 69.83 9.00e-49 182.00
IUUC-Fox-037808 Fusarium oxysporum 77.33 2.00e-72 261.00
IUUC-Fso-038232 Fusarium solani 78.00 1.00e-72 262.00
IUUC-Gmo-038517 Gadus morhua 69.80 2.00e-63 232.00
IUUC-Ggr-039875 Gaeumannomyces graminis 77.33 1.00e-71 259.00
IUUC-Gga-040588 Gallus gallus 69.80 2.00e-63 232.00
IUUC-Gac-041504 Gasterosteus aculeatus 69.80 3.00e-63 231.00
IUUC-Gma-043865 Glycine max 65.10 8.00e-61 223.00
IUUC-Ggo-044896 Gorilla gorilla 69.80 2.00e-63 232.00
IUUC-Hsa-046383 Homo sapiens 69.80 2.00e-63 232.00
IUUC-Hvu-047054 Hordeum vulgare 63.76 1.00e-59 219.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 69.80 2.00e-63 232.00
IUUC-Kpa-049225 Komagataella pastoris 80.00 3.00e-75 271.00
IUUC-Lch-049964 Latimeria chalumnae 69.80 2.00e-63 232.00
IUUC-Lpe-051301 Leersia perrieri 65.10 3.00e-60 221.00
IUUC-Loc-051731 Lepisosteus oculatus 69.80 2.00e-63 232.00
IUUC-Laf-053680 Loxodonta africana 69.80 2.00e-63 232.00
IUUC-Mcc-054819 Macaca mulatta 69.80 1.00e-63 233.00
IUUC-Meu-056231 Macropus eugenii 69.80 2.00e-63 232.00
IUUC-Mor-057087 Magnaporthe oryzae 75.56 3.00e-63 231.00
IUUC-Mpo-057498 Magnaporthe poae 77.33 2.00e-71 259.00
IUUC-Mtr-058305 Medicago truncatula 65.10 2.00e-60 222.00
IUUC-Mla-058876 Melampsora laricipopulina 71.81 6.00e-60 220.00
IUUC-Mga-059863 Meleagris gallopavo 65.69 8.00e-55 203.00
IUUC-Mvi-060330 Microbotryum violaceum 73.15 7.00e-58 213.00
IUUC-Mmr-060630 Microcebus murinus 69.80 2.00e-63 231.00
IUUC-Mdo-062292 Monodelphis domestica 69.80 2.00e-63 232.00
IUUC-Mmu-063680 Mus musculus 69.80 2.00e-63 232.00
IUUC-Mac-064774 Musa acuminata 65.10 3.00e-60 221.00
IUUC-Mpu-065803 Mustela putorius furo 69.80 2.00e-63 231.00
IUUC-Mlu-067147 Myotis lucifugus 69.80 2.00e-63 231.00
IUUC-Nfi-068580 Neosartorya fischeri 76.67 4.00e-71 257.00
IUUC-Ncr-068913 Neurospora crassa 78.00 1.00e-71 259.00
IUUC-Nle-069121 Nomascus leucogenys 69.80 2.00e-63 232.00
IUUC-Opr-070935 Ochotona princeps 69.80 2.00e-63 231.00
IUUC-Ont-071716 Oreochromis niloticus 69.80 9.00e-64 233.00
IUUC-Oan-072706 Ornithorhynchus anatinus 63.70 7.00e-56 207.00
IUUC-Ocu-074550 Oryctolagus cuniculus 69.80 3.00e-63 232.00
IUUC-Oba-075896 Oryza barthii 65.10 5.00e-60 220.00
IUUC-Obr-076713 Oryza brachyantha 65.10 3.00e-60 221.00
IUUC-Ogl-077116 Oryza glaberrima 65.10 3.00e-60 221.00
IUUC-Ogu-078696 Oryza glumaepatula 65.10 3.00e-60 221.00
IUUC-Oin-079099 Oryza indica 65.10 3.00e-60 221.00
IUUC-Olo-081018 Oryza longistaminata 55.15 2.00e-50 189.00
IUUC-Ome-081285 Oryza meridionalis 65.10 3.00e-60 221.00
IUUC-Oni-082088 Oryza nivara 65.10 3.00e-60 221.00
IUUC-Opu-083310 Oryza punctata 65.10 3.00e-60 221.00
IUUC-Oru-084449 Oryza rufipogon 65.10 3.00e-60 221.00
IUUC-Osa-085923 Oryza sativa 65.10 3.00e-60 221.00
IUUC-Ola-087448 Oryzias latipes 69.80 8.00e-64 233.00
IUUC-Olu-087830 Ostreococcus lucimarinus 62.42 3.00e-49 184.00
IUUC-Oga-088659 Otolemur garnettii 69.80 2.00e-63 232.00
IUUC-Oar-090141 Ovis aries 69.80 2.00e-63 231.00
IUUC-Ptr-091305 Pan troglodytes 69.80 2.00e-63 232.00
IUUC-Pan-092511 Papio anubis 69.80 2.00e-63 231.00
IUUC-Psi-093968 Pelodiscus sinensis 69.80 2.00e-63 232.00
IUUC-Pma-094376 Petromyzon marinus 69.80 7.00e-63 230.00
IUUC-Pno-094935 Phaeosphaeria nodorum 74.67 3.00e-69 251.00
IUUC-Ppa-095689 Physcomitrella patens 63.09 1.00e-52 196.00
IUUC-Pfo-096784 Poecilia formosa 69.80 6.00e-64 233.00
IUUC-Pab-097972 Pongo abelii 69.80 2.00e-63 232.00
IUUC-Pop-099517 Populus trichocarpa 65.10 2.00e-60 222.00
IUUC-Pca-100906 Procavia capensis 65.10 2.00e-57 211.00
IUUC-Ppe-101594 Prunus persica 65.10 2.00e-60 222.00
IUUC-Pva-102380 Pteropus vampyrus 69.13 2.00e-61 224.00
IUUC-Pgr-103611 Puccinia graminis 71.81 3.00e-60 221.00
IUUC-Ptt-103971 Puccinia triticina 76.72 8.00e-47 176.00
IUUC-Pte-104378 Pyrenophora teres 75.33 9.00e-70 253.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 75.33 9.00e-70 253.00
IUUC-Rno-105772 Rattus norvegicus 69.80 1.00e-63 233.00
IUUC-Sce-106283 Saccharomyces cerevisiae 100.00 3.00e-88 314.00
IUUC-Sha-107650 Sarcophilus harrisii 69.13 4.00e-62 227.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 76.67 9.00e-62 226.00
IUUC-Spo-108073 Schizosaccharomyces pombe 77.33 6.00e-62 227.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 76.67 4.00e-71 257.00
IUUC-Smo-109512 Selaginella moellendorffii 63.09 3.00e-59 218.00
IUUC-Sit-110731 Setaria italica 65.10 3.00e-60 221.00
IUUC-Sly-111506 Solanum lycopersicum 65.10 1.00e-60 222.00
IUUC-Stu-112080 Solanum tuberosum 65.10 1.00e-60 222.00
IUUC-Sar-113429 Sorex araneus 69.80 2.00e-63 231.00
IUUC-Sbi-114788 Sorghum bicolor 65.10 2.00e-60 222.00
IUUC-Sre-115106 Sporisorium reilianum 71.14 1.00e-58 216.00
IUUC-Ssc-116265 Sus scrofa 69.80 2.00e-63 232.00
IUUC-Tgu-117383 Taeniopygia guttata 69.80 2.00e-63 232.00
IUUC-Tru-118576 Takifugu rubripes 69.80 8.00e-64 233.00
IUUC-Tsy-119000 Tarsius syrichta 69.80 2.00e-63 231.00
IUUC-Tni-119745 Tetraodon nigroviridis 69.80 8.00e-64 233.00
IUUC-Tca-121827 Theobroma cacao 65.10 1.00e-60 222.00
IUUC-Tre-122002 Trichoderma reesei 76.67 4.00e-72 260.00
IUUC-Tvi-122331 Trichoderma virens 76.67 4.00e-72 260.00
IUUC-Tae-125400 Triticum aestivum 65.10 5.00e-60 220.00
IUUC-Tur-126866 Triticum urartu 63.76 3.00e-59 218.00
IUUC-Tme-127148 Tuber melanosporum 78.00 1.00e-71 259.00
IUUC-Tbe-127921 Tupaia belangeri 68.46 7.00e-60 220.00
IUUC-Ttr-129121 Tursiops truncatus 69.80 2.00e-63 231.00
IUUC-Uma-129561 Ustilago maydis 71.14 5.00e-59 217.00
IUUC-Vda-129711 Verticillium dahliae 77.33 4.00e-72 260.00
IUUC-Vpa-130570 Vicugna pacos 61.94 9.00e-49 182.00
IUUC-Vvi-131108 Vitis vinifera 65.77 5.00e-61 224.00
IUUC-Xtr-131824 Xenopus tropicalis 69.80 9.00e-64 233.00
IUUC-Xma-133667 Xiphophorus maculatus 69.80 8.00e-64 233.00
IUUC-Yli-134660 Yarrowia lipolytica 75.17 2.00e-70 255.00
IUUC-Zma-135584 Zea mays 65.10 3.00e-60 221.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved