• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
  • PPI
    • iRefIndex
    • Mentha
  • Proteomics

Tag Content
UUCD2 ID IUUC-Bta-012673
UUCD1 version UUC-BoT-01091
Ensembl Protein ID ENSBTAP00000035448.4
UniProt Accession Q2TBG8; UCHL3_BOVIN
Genbank Protein ID AAI10248.1
Protein Name Ubiquitin carboxyl-terminal hydrolase isozyme L3; Ubiquitin thioesterase L3
Genbank Nucleotide ID BC110247
Gene Name UCHL3
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000008024.5 ENSBTAT00000035577.4 ENSBTAP00000035448.4
Status Unreviewed
Classification
Family E-Value Score Start End
DUB/UCH 6.70e-73 246.1 3 230
Active Site
Position(s) Description Evidence
95 Nucleophile ECO:0000255|PROSITE-ProRule:PRU10091}
169 Proton donor ECO:0000255|PROSITE-ProRule:PRU10091}
Domain Profile

   DUB/UCH

   S: 5    vkewleLesdPglftllvedfgvkrdiqveelysLdpenlglyqepvegllllFkinekressrksqvtsndlevvdediiktiffakq 93
    +++wl+Le++P++ +++++++g++ ++q+ ++y++dpe l+++++pv+++lllF+i+ek+e +r+++ ++++++++d++++++f+kq
   Q: 3 GQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEE--EEKIKSQGQDVTSSVYFMKQ 89
    589*************************************************************766..5589**************** PP
   S: 94 vigNsCatyAllsvllncedkl.ldlGttlsrlkestkaespenkalalgnqqvlecihnslariesrseperqdedneqytkeafhfv 181
    +i+N+C+t++l+++++n++dk+ ++ G+tl++++e++ ++spe++a+ l+n ++++++h++ a+++++++p+ + +k +hf+
   Q: 90 TISNACGTIGLIHAIANNKDKMhFESGSTLKKFLEESASMSPEERARYLENYDAIRVTHETSAHEGQTEAPNID-------EKVDLHFI 171
    ***********************************************************************877.......7899**** PP
   S: 182 syvningrlyeldglkpfPldlgkkketeelkdklkvvraflerikllesdeirfnllaivad 244
    ++v+++g+lyeldg+kpfP+++g++++++ l+d+++v+++f+er + de+rfn++a++a+
   Q: 172 ALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMER----DPDELRFNAIALSAA 230
    ********************************************....***********9875 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome (By similarity).
Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome (By similarity).
Protein Sequence
(Fasta)
MEGQRWLPLE ANPEVTNQFL KQLGLHPNWQ FVDVYGMDPE LLSMVPRPVC AVLLLFPITE 60
KYEVFRTEEE EKIKSQGQDV TSSVYFMKQT ISNACGTIGL IHAIANNKDK MHFESGSTLK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-012673|DUB,UCH|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GCTGGAGAGC GGCCGGGCGG AGCGGCCATG GAGGGTCAAC GCTGGCTGCC GCTGGAGGCC 60
AATCCCGAGG TGAGCGCGCC TCCAGTCTCG GCCTAAGGCC GCGGGCAGGG GCGGGGGGAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-012673|DUB,UCH|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0378--Hydrolase
KW-0597--Phosphoprotein
KW-0645--Protease
KW-1185--Reference proteome
KW-0788--Thiol protease
KW-0833--Ubl conjugation pathway

Interpro

IPR001578--Peptidase_C12_UCH

PROSITE

PS00140--UCH_1

Pfam

PF01088--Peptidase_C12

PRINTS

PR00707--UBCTHYDRLASE

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0070062--C:extracellular exosome
GO:0005634--C:nucleus
GO:0004843--F:thiol-dependent ubiquitin-specific protease activity
GO:0016579--P:protein deubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG bta:520170
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000360 Aegilops tauschii 44.49 5.00e-54 204.00
IUUC-Aml-001344 Ailuropoda melanoleuca 99.13 2.00e-136 478.00
IUUC-Atr-002931 Amborella trichopoda 47.95 5.00e-49 187.00
IUUC-Apl-003949 Anas platyrhynchos 86.85 4.00e-104 370.00
IUUC-Aca-004924 Anolis carolinensis 81.82 2.00e-114 404.00
IUUC-Aly-005721 Arabidopsis lyrata 50.66 1.00e-60 226.00
IUUC-Ath-006827 Arabidopsis thaliana 51.33 5.00e-61 227.00
IUUC-Ago-007950 Ashbya gossypii 35.14 1.00e-27 116.00
IUUC-Acl-008305 Aspergillus clavatus 39.56 1.00e-40 159.00
IUUC-Afl-008611 Aspergillus flavus 40.25 7.00e-44 170.00
IUUC-Afu-008945 Aspergillus fumigatus 40.68 1.00e-43 169.00
IUUC-Ani-009339 Aspergillus nidulans 40.51 3.00e-44 171.00
IUUC-Ang-009691 Aspergillus niger 38.72 4.00e-43 167.00
IUUC-Aor-009961 Aspergillus oryzae 40.25 7.00e-44 170.00
IUUC-Ate-010316 Aspergillus terreus 40.85 1.00e-44 173.00
IUUC-Ame-011157 Astyanax mexicanus 72.61 1.00e-101 362.00
IUUC-Bgr-012125 Blumeria graminis 36.29 8.00e-39 153.00
IUUC-Bci-013734 Botrytis cinerea 38.03 1.00e-42 166.00
IUUC-Bdi-014330 Brachypodium distachyon 47.14 3.00e-57 214.00
IUUC-Bol-015214 Brassica oleracea 52.86 1.00e-63 236.00
IUUC-Bra-017491 Brassica rapa 53.74 2.00e-63 235.00
IUUC-Cel-018302 Caenorhabditis elegans 39.64 2.00e-35 141.00
IUUC-Cfa-020371 Canis familiaris 96.32 1.00e-106 378.00
IUUC-Cpo-022036 Cavia porcellus 96.52 1.00e-131 461.00
IUUC-Cre-022599 Chlamydomonas reinhardtii 44.19 2.00e-38 152.00
IUUC-Csa-023854 Chlorocebus sabaeus 99.13 1.00e-135 475.00
IUUC-Cin-025545 Ciona intestinalis 49.78 5.00e-67 247.00
IUUC-Cgl-026409 Colletotrichum gloeosporioides 34.47 2.00e-32 132.00
IUUC-Cne-026914 Cryptococcus neoformans 35.19 5.00e-30 124.00
IUUC-Cme-027216 Cyanidioschyzon merolae 37.39 3.00e-28 118.00
IUUC-Dre-028356 Danio rerio 74.78 8.00e-104 369.00
IUUC-Dse-031461 Dothistroma septosporum 40.08 1.00e-38 152.00
IUUC-Dme-032146 Drosophila melanogaster 51.56 3.00e-63 234.00
IUUC-Eca-033220 Equus caballus 98.70 2.00e-135 474.00
IUUC-Fca-036421 Felis catus 99.13 2.00e-136 478.00
IUUC-Fal-036773 Ficedula albicollis 86.64 8.00e-106 375.00
IUUC-Fox-037830 Fusarium oxysporum 36.80 2.00e-40 158.00
IUUC-Fso-038259 Fusarium solani 36.68 1.00e-38 155.00
IUUC-Gmo-039468 Gadus morhua 68.26 4.00e-84 303.00
IUUC-Ggr-039832 Gaeumannomyces graminis 37.12 4.00e-37 147.00
IUUC-Gga-041205 Gallus gallus 85.22 4.00e-111 393.00
IUUC-Gac-041629 Gasterosteus aculeatus 67.98 6.00e-88 316.00
IUUC-Gma-043057 Glycine max 50.22 3.00e-54 204.00
IUUC-Ggo-044533 Gorilla gorilla 98.70 4.00e-135 473.00
IUUC-Hsa-046754 Homo sapiens 99.13 2.00e-136 478.00
IUUC-Hvu-047176 Hordeum vulgare 41.48 2.00e-44 172.00
IUUC-Itr-047992 Ictidomys tridecemlineatus 96.84 2.00e-90 323.00
IUUC-Kpa-049123 Komagataella pastoris 36.62 6.00e-32 130.00
IUUC-Lch-049685 Latimeria chalumnae 78.07 6.00e-110 389.00
IUUC-Lpe-051377 Leersia perrieri 46.31 9.00e-48 182.00
IUUC-Loc-051988 Lepisosteus oculatus 76.09 8.00e-106 375.00
IUUC-Lma-053316 Leptosphaeria maculans 40.26 8.00e-42 163.00
IUUC-Laf-053985 Loxodonta africana 97.40 1.00e-133 468.00
IUUC-Mcc-055888 Macaca mulatta 97.83 1.00e-132 464.00
IUUC-Mor-057271 Magnaporthe oryzae 37.12 2.00e-41 161.00
IUUC-Mpo-057343 Magnaporthe poae 32.19 3.00e-22 97.80
IUUC-Mtr-057713 Medicago truncatula 49.12 3.00e-54 204.00
IUUC-Mla-058942 Melampsora laricipopulina 45.37 1.00e-47 182.00
IUUC-Mga-059702 Meleagris gallopavo 86.38 1.00e-103 368.00
IUUC-Mvi-060249 Microbotryum violaceum 44.30 2.00e-42 165.00
IUUC-Mmr-061284 Microcebus murinus 99.37 8.00e-92 329.00
IUUC-Mdo-062639 Monodelphis domestica 79.48 4.00e-122 430.00
IUUC-Mmu-063299 Mus musculus 97.39 9.00e-135 471.00
IUUC-Mac-065075 Musa acuminata 45.85 4.00e-54 204.00
IUUC-Mpu-066769 Mustela putorius furo 99.13 2.00e-136 478.00
IUUC-Mlu-066937 Myotis lucifugus 96.96 1.00e-132 465.00
IUUC-Nfi-068320 Neosartorya fischeri 40.76 1.00e-44 172.00
IUUC-Ncr-068673 Neurospora crassa 38.96 3.00e-45 174.00
IUUC-Nle-069175 Nomascus leucogenys 99.06 9.00e-124 435.00
IUUC-Opr-070652 Ochotona princeps 99.13 1.00e-63 236.00
IUUC-Ont-072170 Oreochromis niloticus 70.18 2.00e-89 321.00
IUUC-Oan-073247 Ornithorhynchus anatinus 93.81 2.00e-59 220.00
IUUC-Ocu-074422 Oryctolagus cuniculus 98.26 5.00e-136 476.00
IUUC-Oba-075098 Oryza barthii 42.48 8.00e-51 192.00
IUUC-Obr-076041 Oryza brachyantha 45.61 2.00e-55 208.00
IUUC-Ogl-076980 Oryza glaberrima 45.18 3.00e-54 204.00
IUUC-Ogu-078978 Oryza glumaepatula 38.74 3.00e-48 185.00
IUUC-Oin-079285 Oryza indica 42.04 5.00e-50 190.00
IUUC-Olo-080671 Oryza longistaminata 42.48 3.00e-50 191.00
IUUC-Ome-081428 Oryza meridionalis 41.59 7.00e-49 186.00
IUUC-Oni-082406 Oryza nivara 42.48 8.00e-51 192.00
IUUC-Opu-083305 Oryza punctata 42.48 3.00e-49 188.00
IUUC-Oru-084969 Oryza rufipogon 42.48 8.00e-51 192.00
IUUC-Osa-085830 Oryza sativa 45.18 3.00e-54 204.00
IUUC-Ola-086893 Oryzias latipes 67.98 9.00e-86 309.00
IUUC-Olu-087858 Ostreococcus lucimarinus 44.93 7.00e-53 199.00
IUUC-Oga-088055 Otolemur garnettii 98.70 4.00e-135 473.00
IUUC-Oar-090319 Ovis aries 99.57 4.00e-137 479.00
IUUC-Pan-092714 Papio anubis 98.70 6.00e-135 472.00
IUUC-Psi-094036 Pelodiscus sinensis 86.18 2.00e-105 375.00
IUUC-Pma-094412 Petromyzon marinus 65.58 1.00e-55 208.00
IUUC-Pno-094997 Phaeosphaeria nodorum 36.22 2.00e-34 139.00
IUUC-Ppa-095519 Physcomitrella patens 51.11 7.00e-65 239.00
IUUC-Pfo-096182 Poecilia formosa 67.83 1.00e-88 318.00
IUUC-Pab-098216 Pongo abelii 98.61 4.00e-82 296.00
IUUC-Pop-099282 Populus trichocarpa 49.12 6.00e-54 203.00
IUUC-Ppe-101332 Prunus persica 48.67 2.00e-56 212.00
IUUC-Pgr-103430 Puccinia graminis 47.06 1.00e-50 192.00
IUUC-Ptt-103955 Puccinia triticina 48.71 3.00e-51 194.00
IUUC-Pte-104414 Pyrenophora teres 38.89 4.00e-39 154.00
IUUC-Pyt-104753 Pyrenophora triticirepentis 34.03 3.00e-34 138.00
IUUC-Rno-105096 Rattus norvegicus 96.52 1.00e-133 468.00
IUUC-Sce-106412 Saccharomyces cerevisiae 36.08 3.00e-28 118.00
IUUC-Sha-106677 Sarcophilus harrisii 93.55 5.00e-121 426.00
IUUC-Sja-107753 Schizosaccharomyces japonicus 30.95 2.00e-26 112.00
IUUC-Spo-108322 Schizosaccharomyces pombe 31.00 2.00e-26 112.00
IUUC-Ssl-108641 Sclerotinia sclerotiorum 37.61 2.00e-38 152.00
IUUC-Smo-108914 Selaginella moellendorffii 49.14 2.00e-54 205.00
IUUC-Sit-110163 Setaria italica 48.28 8.00e-57 213.00
IUUC-Sly-111613 Solanum lycopersicum 50.22 8.00e-63 233.00
IUUC-Stu-112526 Solanum tuberosum 50.88 3.00e-58 218.00
IUUC-Sbi-114545 Sorghum bicolor 47.60 1.00e-54 206.00
IUUC-Sre-114961 Sporisorium reilianum 42.49 5.00e-41 160.00
IUUC-Ssc-115255 Sus scrofa 98.58 6.00e-124 436.00
IUUC-Tgu-117003 Taeniopygia guttata 85.65 2.00e-110 391.00
IUUC-Tru-118330 Takifugu rubripes 62.84 1.00e-68 254.00
IUUC-Tsy-119488 Tarsius syrichta 97.37 7.00e-63 233.00
IUUC-Tni-120042 Tetraodon nigroviridis 63.59 9.00e-71 261.00
IUUC-Tca-120976 Theobroma cacao 48.23 1.00e-56 212.00
IUUC-Tre-122149 Trichoderma reesei 38.70 3.00e-43 168.00
IUUC-Tvi-122450 Trichoderma virens 38.70 1.00e-43 169.00
IUUC-Tae-122693 Triticum aestivum 45.65 2.00e-54 206.00
IUUC-Tur-126250 Triticum urartu 44.49 1.00e-53 202.00
IUUC-Tme-126961 Tuber melanosporum 37.02 5.00e-36 144.00
IUUC-Uma-129382 Ustilago maydis 41.81 1.00e-43 169.00
IUUC-Vda-129678 Verticillium dahliae 32.07 2.00e-31 128.00
IUUC-Vpa-130783 Vicugna pacos 100.00 4.00e-64 237.00
IUUC-Vvi-131661 Vitis vinifera 48.47 1.00e-57 216.00
IUUC-Xtr-132428 Xenopus tropicalis 73.48 5.00e-106 376.00
IUUC-Xma-134245 Xiphophorus maculatus 67.11 2.00e-88 318.00
IUUC-Yli-134570 Yarrowia lipolytica 35.90 2.00e-36 145.00
IUUC-Zma-134740 Zea mays 46.72 3.00e-56 211.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved