• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
  • PPI
    • iRefIndex
    • Mentha
  • Proteomics

Tag Content
iUUCD ID IUUC-Bci-013959
Ensembl Protein ID Bcin02g02570.1
UniProt Accession A6RPU4; ATG8_BOTFB
Genbank Protein ID EDN32090.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier atg8
Genbank Nucleotide ID CH476849
Gene Name atg8; BC1G_02467
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
Bcin02g02570 Bcin02g02570.1 Bcin02g02570.1
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 1.20e-47 159.6 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyv 95
    krk+e+e+ir+k++d+iPvi+ek +k++i+++dkkkylvPsdltvgq+v++irkr++l +e+a+f++v+++l++++a +++iyee+kdedgfly+
   Q: 13 KRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPSDLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYI 107
    699******************************************************************************************** PP
   S: 96 ayaseetfG 104
    +y++e+tfG
   Q: 108 SYSGENTFG 116
    ********9 PP
   

Organism Botrytis cinerea
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MRSKFKDEHP FEKRKAEAER IRQKYNDRIP VICEKVEKSD IATIDKKKYL VPSDLTVGQF 60
VYVIRKRIKL SPEKAIFIFV DEVLPPTAAL MSSIYEEHKD EDGFLYISYS GENTFGEALE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bci-013959|ULD,ATG8|Botrytis cinerea
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCGATCCA AGTTTAAGGA CGAGCACCCA TTCGAGAAGC GCAAGGCTGA AGCTGAACGC 60
ATCGTACGTC GCATTCCAAC CTCCTAACCA TTACCTCCCC TTCCCCACCA TCACCATCGT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bci-013959|ULD,ATG8|Botrytis cinerea
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0015031--P:protein transport

KEGG bfu:BC1G_02467
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 75.21 3.00e-51 191.00
IUUC-Aml-001323 Ailuropoda melanoleuca 60.34 9.00e-40 153.00
IUUC-Atr-002791 Amborella trichopoda 80.87 5.00e-52 194.00
IUUC-Apl-003994 Anas platyrhynchos 56.03 7.00e-38 147.00
IUUC-Aca-005288 Anolis carolinensis 59.48 2.00e-39 152.00
IUUC-Aly-005987 Arabidopsis lyrata 81.58 8.00e-53 196.00
IUUC-Ath-006958 Arabidopsis thaliana 80.87 2.00e-44 168.00
IUUC-Ago-007898 Ashbya gossypii 71.93 2.00e-48 182.00
IUUC-Acl-008314 Aspergillus clavatus 95.76 1.00e-63 232.00
IUUC-Afl-008708 Aspergillus flavus 96.58 1.00e-63 232.00
IUUC-Afu-009097 Aspergillus fumigatus 95.76 1.00e-63 232.00
IUUC-Ani-009196 Aspergillus nidulans 94.92 8.00e-63 229.00
IUUC-Ang-009530 Aspergillus niger 95.76 1.00e-63 232.00
IUUC-Aor-009909 Aspergillus oryzae 96.58 1.00e-63 232.00
IUUC-Ate-010358 Aspergillus terreus 95.76 1.00e-63 232.00
IUUC-Ame-010914 Astyanax mexicanus 60.68 2.00e-40 155.00
IUUC-Bgr-012248 Blumeria graminis 95.76 5.00e-63 230.00
IUUC-Bta-012805 Bos taurus 60.34 9.00e-40 153.00
IUUC-Bdi-014390 Brachypodium distachyon 79.66 9.00e-52 193.00
IUUC-Bol-016488 Brassica oleracea 80.34 3.00e-52 195.00
IUUC-Bra-016921 Brassica rapa 81.58 8.00e-53 196.00
IUUC-Cel-018200 Caenorhabditis elegans 56.20 1.00e-37 146.00
IUUC-Cja-019369 Callithrix jacchus 60.34 9.00e-40 153.00
IUUC-Cfa-020603 Canis familiaris 60.34 9.00e-40 153.00
IUUC-Cpo-021831 Cavia porcellus 59.48 2.00e-39 152.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 83.33 7.00e-46 174.00
IUUC-Csa-024117 Chlorocebus sabaeus 60.34 9.00e-40 153.00
IUUC-Cho-025008 Choloepus hoffmanni 52.14 3.00e-35 138.00
IUUC-Cin-025297 Ciona intestinalis 58.62 1.00e-39 152.00
IUUC-Csv-026146 Ciona savignyi 36.75 9.00e-21 90.50
IUUC-Cgl-026691 Colletotrichum gloeosporioides 70.62 5.00e-57 211.00
IUUC-Cne-026889 Cryptococcus neoformans 87.18 1.00e-58 216.00
IUUC-Cme-027158 Cyanidioschyzon merolae 27.50 2.10e+00 24.30
IUUC-Dre-028351 Danio rerio 60.68 2.00e-40 156.00
IUUC-Dno-029331 Dasypus novemcinctus 59.48 2.00e-39 152.00
IUUC-Dor-030245 Dipodomys ordii 60.34 9.00e-40 153.00
IUUC-Dse-031428 Dothistroma septosporum 97.46 1.00e-64 235.00
IUUC-Dme-031813 Drosophila melanogaster 61.86 1.00e-41 159.00
IUUC-Ete-032671 Echinops telfairi 61.21 5.00e-40 154.00
IUUC-Eca-034113 Equus caballus 59.48 3.00e-39 152.00
IUUC-Eeu-035131 Erinaceus europaeus 59.30 3.00e-27 110.00
IUUC-Fca-036493 Felis catus 60.34 1.00e-39 153.00
IUUC-Fal-036896 Ficedula albicollis 59.48 3.00e-39 151.00
IUUC-Fox-037846 Fusarium oxysporum 95.83 7.00e-65 236.00
IUUC-Fso-038134 Fusarium solani 96.61 4.00e-64 234.00
IUUC-Gmo-039671 Gadus morhua 60.17 1.00e-40 156.00
IUUC-Ggr-039770 Gaeumannomyces graminis 91.80 1.00e-62 229.00
IUUC-Gga-040257 Gallus gallus 60.34 4.00e-40 154.00
IUUC-Gac-041604 Gasterosteus aculeatus 60.34 2.00e-40 155.00
IUUC-Gma-044021 Glycine max 78.26 8.00e-52 193.00
IUUC-Ggo-044860 Gorilla gorilla 60.34 1.00e-39 152.00
IUUC-Hsa-045905 Homo sapiens 60.34 9.00e-40 153.00
IUUC-Hvu-047588 Hordeum vulgare 79.13 5.00e-51 191.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 60.34 9.00e-40 153.00
IUUC-Kpa-049124 Komagataella pastoris 82.05 8.00e-55 203.00
IUUC-Lch-049542 Latimeria chalumnae 58.62 2.00e-39 152.00
IUUC-Lpe-051292 Leersia perrieri 80.87 4.00e-52 194.00
IUUC-Loc-052290 Lepisosteus oculatus 58.68 2.00e-40 155.00
IUUC-Laf-054203 Loxodonta africana 60.34 9.00e-40 153.00
IUUC-Mcc-055307 Macaca mulatta 60.34 9.00e-40 153.00
IUUC-Meu-056515 Macropus eugenii 59.48 2.00e-39 152.00
IUUC-Mor-057276 Magnaporthe oryzae 90.98 2.00e-62 228.00
IUUC-Mpo-057469 Magnaporthe poae 91.80 3.00e-62 228.00
IUUC-Mtr-057664 Medicago truncatula 77.39 1.00e-45 172.00
IUUC-Mla-059098 Melampsora laricipopulina 87.80 4.00e-61 224.00
IUUC-Mga-060108 Meleagris gallopavo 55.83 1.00e-38 149.00
IUUC-Mvi-060496 Microbotryum violaceum 89.57 3.00e-58 215.00
IUUC-Mmr-061776 Microcebus murinus 60.34 9.00e-40 153.00
IUUC-Mdo-061915 Monodelphis domestica 59.48 2.00e-39 152.00
IUUC-Mmu-064157 Mus musculus 60.34 9.00e-40 153.00
IUUC-Mac-064739 Musa acuminata 78.26 3.00e-44 168.00
IUUC-Mpu-066028 Mustela putorius furo 60.34 2.00e-39 152.00
IUUC-Mlu-067166 Myotis lucifugus 60.34 9.00e-40 153.00
IUUC-Nfi-068367 Neosartorya fischeri 95.76 1.00e-63 232.00
IUUC-Ncr-068894 Neurospora crassa 96.58 7.00e-64 233.00
IUUC-Nle-069220 Nomascus leucogenys 60.34 9.00e-40 153.00
IUUC-Opr-070777 Ochotona princeps 60.34 1.00e-39 153.00
IUUC-Ont-072343 Oreochromis niloticus 59.48 3.00e-39 151.00
IUUC-Oan-073485 Ornithorhynchus anatinus 61.90 2.00e-36 142.00
IUUC-Ocu-074148 Oryctolagus cuniculus 60.34 9.00e-40 153.00
IUUC-Oba-075238 Oryza barthii 75.21 2.00e-51 192.00
IUUC-Obr-076830 Oryza brachyantha 80.00 3.00e-52 194.00
IUUC-Ogl-077457 Oryza glaberrima 80.00 2.00e-51 191.00
IUUC-Ogu-078489 Oryza glumaepatula 75.21 2.00e-51 192.00
IUUC-Oin-079330 Oryza indica 75.21 2.00e-51 192.00
IUUC-Olo-080412 Oryza longistaminata 80.00 2.00e-51 191.00
IUUC-Ome-082013 Oryza meridionalis 75.21 2.00e-51 192.00
IUUC-Oni-082811 Oryza nivara 75.21 2.00e-51 192.00
IUUC-Opu-083501 Oryza punctata 80.00 3.00e-52 194.00
IUUC-Oru-084197 Oryza rufipogon 75.21 2.00e-51 192.00
IUUC-Osa-085654 Oryza sativa 75.21 2.00e-51 192.00
IUUC-Ola-086310 Oryzias latipes 58.62 8.00e-39 150.00
IUUC-Olu-087892 Ostreococcus lucimarinus 80.36 2.00e-52 196.00
IUUC-Oga-088312 Otolemur garnettii 60.34 9.00e-40 153.00
IUUC-Oar-089989 Ovis aries 60.34 9.00e-40 153.00
IUUC-Ptr-091108 Pan troglodytes 60.34 9.00e-40 153.00
IUUC-Pan-092269 Papio anubis 59.48 2.00e-39 152.00
IUUC-Psi-093055 Pelodiscus sinensis 55.56 7.00e-38 147.00
IUUC-Pma-094337 Petromyzon marinus 56.90 4.00e-40 154.00
IUUC-Pno-095035 Phaeosphaeria nodorum 97.48 1.00e-65 239.00
IUUC-Ppa-095701 Physcomitrella patens 79.66 2.00e-46 176.00
IUUC-Pfo-096380 Poecilia formosa 58.62 4.00e-39 151.00
IUUC-Pab-097660 Pongo abelii 60.34 9.00e-40 153.00
IUUC-Pop-099400 Populus trichocarpa 79.13 8.00e-46 173.00
IUUC-Pca-100230 Procavia capensis 60.34 9.00e-40 153.00
IUUC-Ppe-101670 Prunus persica 78.26 1.00e-44 169.00
IUUC-Pva-103103 Pteropus vampyrus 55.56 7.00e-38 147.00
IUUC-Pte-104230 Pyrenophora teres 98.32 6.00e-66 240.00
IUUC-Rno-105497 Rattus norvegicus 60.34 9.00e-40 153.00
IUUC-Sce-106150 Saccharomyces cerevisiae 77.59 5.00e-52 194.00
IUUC-Sha-106656 Sarcophilus harrisii 60.34 9.00e-40 153.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 85.71 5.00e-58 214.00
IUUC-Spo-108156 Schizosaccharomyces pombe 84.03 4.00e-49 184.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 99.19 3.00e-68 248.00
IUUC-Smo-109082 Selaginella moellendorffii 77.97 2.00e-51 192.00
IUUC-Sit-110531 Setaria italica 79.82 8.00e-51 190.00
IUUC-Sly-111700 Solanum lycopersicum 80.17 1.00e-51 192.00
IUUC-Stu-112612 Solanum tuberosum 79.31 8.00e-52 193.00
IUUC-Sar-113670 Sorex araneus 55.17 3.00e-35 138.00
IUUC-Sbi-113877 Sorghum bicolor 80.70 4.00e-51 191.00
IUUC-Sre-114964 Sporisorium reilianum 88.14 2.00e-58 215.00
IUUC-Ssc-116182 Sus scrofa 60.34 9.00e-40 153.00
IUUC-Tgu-117195 Taeniopygia guttata 59.48 2.00e-39 152.00
IUUC-Tru-118632 Takifugu rubripes 58.68 2.00e-40 155.00
IUUC-Tsy-118919 Tarsius syrichta 55.56 7.00e-38 147.00
IUUC-Tni-120706 Tetraodon nigroviridis 58.62 8.00e-39 150.00
IUUC-Tca-121335 Theobroma cacao 75.21 1.00e-46 177.00
IUUC-Tre-122077 Trichoderma reesei 96.61 3.00e-64 234.00
IUUC-Tvi-122400 Trichoderma virens 96.61 3.00e-64 234.00
IUUC-Tae-122697 Triticum aestivum 75.21 9.00e-51 191.00
IUUC-Tur-126158 Triticum urartu 74.36 1.00e-50 189.00
IUUC-Tme-126955 Tuber melanosporum 96.55 4.00e-62 228.00
IUUC-Tbe-127765 Tupaia belangeri 63.95 2.00e-30 121.00
IUUC-Ttr-128205 Tursiops truncatus 59.48 2.00e-39 152.00
IUUC-Uma-129435 Ustilago maydis 88.03 2.00e-58 215.00
IUUC-Vda-129807 Verticillium dahliae 95.76 7.00e-64 233.00
IUUC-Vpa-130804 Vicugna pacos 58.62 5.00e-39 150.00
IUUC-Vvi-130830 Vitis vinifera 80.87 2.00e-45 172.00
IUUC-Xtr-132685 Xenopus tropicalis 59.48 1.00e-39 152.00
IUUC-Xma-133400 Xiphophorus maculatus 58.68 3.00e-40 155.00
IUUC-Yli-134327 Yarrowia lipolytica 88.89 4.00e-52 194.00
IUUC-Zma-135270 Zea mays 80.87 5.00e-52 194.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved