• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Hsa-046000
UUCD1 version UUC-HoS-00116
Ensembl Protein ID ENSP00000264414.4
UniProt Accession Q13618; A8K536; B8ZZC3; O75415; Q569L3; Q9UBI8; Q9UET7; CUL3_HUMAN
Genbank Protein ID AAC36304.1; BAA31592.2; AAC36682.1; AAQ01660.1; BAF83840.1; EAW70828.1; AAH31844.1; AAH39598.1; AAH92409.1; AAC50546.1; AAC28621.1
Protein Name Cullin-3
Genbank Nucleotide ID AF064087; AB014517; AF062537; AY337761; AK291151; AC073052; BC031844; BC039598; BC092409; U58089; AF052147
Gene Name CUL3; KIAA0617
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSG00000036257.12 ENST00000264414.8 ENSP00000264414.4
ENSG00000036257.12 ENST00000454323.1 ENSP00000400558.1
ENSG00000036257.12 ENST00000451538.1 ENSP00000410575.1
ENSG00000036257.12 ENST00000432260.2 ENSP00000484410.1
ENSG00000036257.12 ENST00000436172.1 ENSP00000400935.1
ENSG00000036257.12 ENST00000344951.8 ENSP00000343601.4
ENSG00000036257.12 ENST00000617432.4 ENSP00000477851.1
Annotation
Cancer Mutation
TCGAICGCCOSMICCGAP
IntOGen
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpressTCGAICGC
COSMICTHPAHPMSZDB
DNA & RNA Element
UTRdbAREsitecircBasecircRNADb
CircNetmiRTarBasemicroRNATRANSFAC
miRWalkTargetScanRepTarmiRNAMap
SomamiRmiRcodeRAID2
Protein-protein Interaction
IIDPINAHINTMentha
InWeb_IM
Protein 3D Structure
PDBMMDB
Disease-associated Information
ClinVarGWASdbGWAS CentralOMIM
Drug and target
TTD
Post-translational Modifications (PTMs)
CPLMdbPAFPhosphositePlusdbPTM
HPRDPhospho.ELMUniProtPHOSIDA
BioGRIDmUbiSiDa
DNA Methylation
TCGAICGCCOSMIC
Protein Expression/Proteomics
THPAHPMGPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/Cullin Cullin_N_terminal 15071497
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/Cullin 6.10e-230 766.8 37 665
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/Cullin

   S: 2    lreavkkilrqesvkkeyeelytavynlclskvgaklYkklkevleefi.kqvkkkveesedeqlLktynreWekfreqlkvlrkifayldr 92
    l++a+++i+r++++ ++eely+++y+++l+k+g+klY+ l+ev++e++ ++v+++v +s ++++L+t+n++W++++++++++r+i++y+dr
   Q: 37 LKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLiNKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDR 128
    799*********************************************99****************************************** PP
   S: 93 tyvkkskkvsevrkLaldlwrkeived..ikkrllelllklieaeRkgeavdrrllsgvveslveLslnklaiykesFEakfleatqefyka 182
    +yv++ ++v++v++L+l ++r+++v++ i+++l ++ll++i++eRkge+vdr +++++++l+ L+l+ +++y+e+FEa+fle+++ef+++
   Q: 129 VYVQQ-NNVENVYNLGLIIFRDQVVRYgcIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQM 219
    *****.************************************************************************************** PP
   S: 183 esaeflqenevdeYlkkvearlneeeeraaryleestetkLlevvekeliakhlesll....aelvallrdkktedlsrmykLlsrvlngle 270
    es++fl+en+ + Y+kkvear+nee er++++l++ste+++++vve+eli+kh+++++ ++lv++l++ ktedl++mykL+srv+ngl+
   Q: 220 ESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVemenSGLVHMLKNGKTEDLGCMYKLFSRVPNGLK 311
    **********************************************************99999***************************** PP
   S: 271 ellkeleshikeqgkaaltaeekekdpkkyVerllelknklqklvseaFnndakFlkaldkafetfvnknsvlkaakspEllAryiDqlLrk 362
    +++++++s+++eqgka++++e + k+p++y++ ll+lk+++++++ e+Fnnd+ F ++++ +fe+f+n n ++spE+l+ +iD++L+k
   Q: 312 TMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLN-----SRSPEYLSLFIDDKLKK 398
    **********************************************************************.....***************** PP
   S: 363 sskglteeeleaqldkvllvfkyisekdvFekyYkkhLakRLlsgksasseaEesviekLkeecgaeftskLerMfqdlkvSedlnrqFkee 454
    ++kglte+e+e++ldk++++f++++ekdvFe+yYk+hLa+RLl++ks+s+++E+++i+kLk+ecg++ftskLe+Mf+d+++S++++++F+++
   Q: 399 GVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQH 490
    ******************************************************************************************** PP
   S: 455 kentees.esvelsvlvLsagaWptasetekvsLPaelektiekfeefYlekhsgRkLqWqhtlgraelkael................... 526
    ++t s +v+l+v+vL++g+Wpt+s+t+k+++P+ ++++e+f++fYl khsgR+L++qh++g+a+l+a++
   Q: 491 LQATGVSlGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFygpvkkedgsevgvggaqv 582
    *****99889*************************************************************************999999998 PP
   S: 527 ...kkgkyelqVstfQmavLLafnnsekvsveelkkatelpeeeLrrtlqsLvssk..kqvlkkepeskeieeedlfsvNqef 604
    +++k++lqVstfQm++L++fnn+ek+++ee++++t++pe+eL r+lqsL+++k ++vl+kep+skeie++++f+vN++f
   Q: 583 tgsNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKptQRVLTKEPKSKEIENGHIFTVNDQF 665
    888888***************************************************************************99 PP
   

Organism Homo sapiens
Functional Description
(View)

Functional Description



     Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. BCR complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins (PubMed:27565346). As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1. The functional specificity of the BCR complex depends on the BTB domain-containing protein as the substrate recognition component. BCR(KLHL42) is involved in ubiquitination of KATNA1. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, BRMS1, H2AFY and DAXX, GLI2 and GLI3. Can also form a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOPL or the heterodimer formed by SPOP and SPOPL; these complexes have lower ubiquitin ligase activity. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B) (PubMed:22358839, PubMed:27716508). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; by mediating ubiquitination of WNK4 (PubMed:23387299, PubMed:23453970, PubMed:23576762). The BCR(KLHL20) E3 ubiquitin ligase complex is involved in interferon response and anterograde Golgi to endosome transport: it mediates both ubiquitination leading to degradation and 'Lys-33'-linked ubiquitination (PubMed:20389280, PubMed:21840486, PubMed:21670212, PubMed:24768539). The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of AURKB (PubMed:19995937). The BCR(KLHL22) ubiquitin ligase complex mediates monoubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation (PubMed:23455478). The BCR(KLHL25) ubiquitin ligase complex is involved in translational homeostasis by mediating ubiquitination and subsequent degradation of hypophosphorylated EIF4EBP1 (4E-BP1) (PubMed:22578813). The BCR(KBTBD8) complex acts by mediating monoubiquitination of NOLC1 and TCOF1, leading to remodel the translational program of differentiating cells in favor of neural crest specification (PubMed:26399832). Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and RBX1, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. The BCR(KCTD17) E3 ubiquitin ligase complex mediates ubiquitination and degradation of TCHP, a down-regulator of cilium assembly, thereby inducing ciliogenesis (PubMed:25270598).
Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. BCR complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins (PubMed:27565346). As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1. The functional specificity of the BCR complex depends on the BTB domain-containing protein as the substrate recognition component. BCR(KLHL42) is involved in ubiquitination of KATNA1. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, BRMS1, H2AFY and DAXX, GLI2 and GLI3. Can also form a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOPL or the heterodimer formed by SPOP and SPOPL; these complexes have lower ubiquitin ligase activity. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B) (PubMed:22358839, PubMed:27716508). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; by mediating ubiquitination of WNK4 (PubMed:23387299, PubMed:23453970, PubMed:23576762). The BCR(KLHL20) E3 ubiquitin ligase complex is involved in interferon response and anterograde Golgi to endosome transport: it mediates both ubiquitination leading to degradation and 'Lys-33'-linked ubiquitination (PubMed:20389280, PubMed:21840486, PubMed:21670212, PubMed:24768539). The BCR(KLHL21) E3 ubiquitin ligase complex regulates localization of the chromosomal passenger complex (CPC) from chromosomes to the spindle midzone in anaphase and mediates the ubiquitination of AURKB (PubMed:19995937). The BCR(KLHL22) ubiquitin ligase complex mediates monoubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation (PubMed:23455478). The BCR(KLHL25) ubiquitin ligase complex is involved in translational homeostasis by mediating ubiquitination and subsequent degradation of hypophosphorylated EIF4EBP1 (4E-BP1) (PubMed:22578813). The BCR(KBTBD8) complex acts by mediating monoubiquitination of NOLC1 and TCOF1, leading to remodel the translational program of differentiating cells in favor of neural crest specification (PubMed:26399832). Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and RBX1, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. The BCR(KCTD17) E3 ubiquitin ligase complex mediates ubiquitination and degradation of TCHP, a down-regulator of cilium assembly, thereby inducing ciliogenesis (PubMed:25270598).
Protein Sequence
(Fasta)
MSNLSKGTGS RKDTKMRIRA FPMTMDEKYV NSIWDLLKNA IQEIQRKNNS GLSFEELYRN 60
AYTMVLHKHG EKLYTGLREV VTEHLINKVR EDVLNSLNNN FLQTLNQAWN DHQTAMVMIR 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Hsa-046000|E3,Cullin|Homo sapiens
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TCTCGCTCAG GCGGAGGAGG AGAAGGAGGA GGAGGAGGAC GACGTTCGGC CTGCGCAGTG 60
AGATGTTTGT CCGTCGCCGC CGCCGCCGCC ATCGCGGAGG AGCGCGATAA AGGGAGCCGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Hsa-046000|E3,Cullin|Homo sapiens
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0007--Acetylation
KW-0025--Alternative splicing
KW-0970--Cilium biogenesis/degradation
KW-0181--Complete proteome
KW-0225--Disease mutation
KW-0931--ER-Golgi transport
KW-0333--Golgi apparatus
KW-1017--Isopeptide bond
KW-0539--Nucleus
KW-0597--Phosphoprotein
KW-0621--Polymorphism
KW-1185--Reference proteome
KW-0813--Transport
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR016157--Cullin_CS
IPR016158--Cullin_homology
IPR001373--Cullin_N
IPR019559--Cullin_neddylation_domain
IPR016159--Cullin_repeat-like_dom
IPR011991--WHTH_DNA-bd_dom

PROSITE

PS01256--CULLIN_1
PS50069--CULLIN_2

Pfam

PF00888--Cullin
PF10557--Cullin_Nedd8

SMART

SM00182--CULLIN
SM00884--Cullin_Nedd8

Gene Ontology

GO:0031463--C:Cul3-RING ubiquitin ligase complex
GO:0005829--C:cytosol
GO:0070062--C:extracellular exosome
GO:0000139--C:Golgi membrane
GO:0016020--C:membrane
GO:0005654--C:nucleoplasm
GO:0005827--C:polar microtubule
GO:0005112--F:Notch binding
GO:0031208--F:POZ domain binding
GO:0031625--F:ubiquitin protein ligase binding
GO:0031145--P:anaphase-promoting complex-dependent catabolic process
GO:0007050--P:cell cycle arrest
GO:0016477--P:cell migration
GO:0030030--P:cell projection organization
GO:0048208--P:COPII vesicle coating
GO:0040016--P:embryonic cleavage
GO:0006888--P:ER to Golgi vesicle-mediated transport
GO:0044346--P:fibroblast apoptotic process
GO:0000082--P:G1/S transition of mitotic cell cycle
GO:0007369--P:gastrulation
GO:0007229--P:integrin-mediated signaling pathway
GO:0097193--P:intrinsic apoptotic signaling pathway
GO:0072576--P:liver morphogenesis
GO:0000165--P:MAPK cascade
GO:0007080--P:mitotic metaphase plate congression
GO:0090090--P:negative regulation of canonical Wnt signaling pathway
GO:0035024--P:negative regulation of Rho protein signal transduction
GO:0000122--P:negative regulation of transcription from RNA polymerase II promoter
GO:0008284--P:positive regulation of cell proliferation
GO:0032467--P:positive regulation of cytokinesis
GO:0045842--P:positive regulation of mitotic metaphase/anaphase transition
GO:0043161--P:proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0006513--P:protein monoubiquitination
GO:0000209--P:protein polyubiquitination
GO:0016567--P:protein ubiquitination
GO:0042787--P:protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0017145--P:stem cell division
GO:0043149--P:stress fiber assembly
GO:0001831--P:trophectodermal cellular morphogenesis
GO:0071630--P:ubiquitin-dependent catabolism of misfolded proteins by nucleus-associated proteasome
GO:0006511--P:ubiquitin-dependent protein catabolic process
GO:0016055--P:Wnt signaling pathway

KEGG hsa:8452
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000335 Aegilops tauschii 47.07 0.00e+00 685.00
IUUC-Aml-002278 Ailuropoda melanoleuca 98.84 0.00e+00 1551.00
IUUC-Atr-002616 Amborella trichopoda 52.36 0.00e+00 774.00
IUUC-Apl-004172 Anas platyrhynchos 99.60 0.00e+00 1516.00
IUUC-Aca-004309 Anolis carolinensis 99.61 0.00e+00 1562.00
IUUC-Aly-005566 Arabidopsis lyrata 51.77 0.00e+00 771.00
IUUC-Ath-007587 Arabidopsis thaliana 52.16 0.00e+00 775.00
IUUC-Ago-007795 Ashbya gossypii 25.29 2.00e-48 187.00
IUUC-Acl-008317 Aspergillus clavatus 36.48 2.00e-144 506.00
IUUC-Afl-008727 Aspergillus flavus 36.53 4.00e-144 505.00
IUUC-Afu-008879 Aspergillus fumigatus 37.96 3.00e-132 466.00
IUUC-Ani-009393 Aspergillus nidulans 35.55 2.00e-135 476.00
IUUC-Ang-009626 Aspergillus niger 36.44 8.00e-141 494.00
IUUC-Aor-010207 Aspergillus oryzae 36.53 1.00e-143 504.00
IUUC-Ate-010305 Aspergillus terreus 37.16 6.00e-140 491.00
IUUC-Ame-011805 Astyanax mexicanus 96.61 0.00e+00 1513.00
IUUC-Bgr-012098 Blumeria graminis 36.02 7.00e-121 428.00
IUUC-Bta-013445 Bos taurus 99.74 0.00e+00 1564.00
IUUC-Bci-013612 Botrytis cinerea 36.61 2.00e-138 486.00
IUUC-Bdi-014269 Brachypodium distachyon 52.68 0.00e+00 749.00
IUUC-Bol-015350 Brassica oleracea 52.29 0.00e+00 773.00
IUUC-Bra-016763 Brassica rapa 52.42 0.00e+00 776.00
IUUC-Cel-018641 Caenorhabditis elegans 48.53 0.00e+00 730.00
IUUC-Cja-019175 Callithrix jacchus 99.87 0.00e+00 1566.00
IUUC-Cfa-020905 Canis familiaris 99.33 0.00e+00 1520.00
IUUC-Cpo-021293 Cavia porcellus 97.65 0.00e+00 1525.00
IUUC-Cre-022776 Chlamydomonas reinhardtii 48.30 0.00e+00 700.00
IUUC-Csa-023800 Chlorocebus sabaeus 100.00 0.00e+00 1568.00
IUUC-Cho-024839 Choloepus hoffmanni 98.68 0.00e+00 1350.00
IUUC-Cin-025201 Ciona intestinalis 71.63 0.00e+00 1028.00
IUUC-Csv-026107 Ciona savignyi 71.24 0.00e+00 1093.00
IUUC-Cgl-026630 Colletotrichum gloeosporioides 35.43 4.00e-124 439.00
IUUC-Cne-027048 Cryptococcus neoformans 34.80 4.00e-117 416.00
IUUC-Cme-027254 Cyanidioschyzon merolae 31.13 1.00e-88 320.00
IUUC-Dre-028488 Danio rerio 97.27 0.00e+00 1526.00
IUUC-Dno-029784 Dasypus novemcinctus 99.61 0.00e+00 1562.00
IUUC-Dor-030682 Dipodomys ordii 92.36 0.00e+00 1364.00
IUUC-Dse-031326 Dothistroma septosporum 35.74 4.00e-128 452.00
IUUC-Dme-032112 Drosophila melanogaster 69.43 0.00e+00 1080.00
IUUC-Ete-032347 Echinops telfairi 81.46 0.00e+00 1197.00
IUUC-Eca-033560 Equus caballus 99.60 0.00e+00 1517.00
IUUC-Eeu-034502 Erinaceus europaeus 97.65 0.00e+00 1341.00
IUUC-Fca-035544 Felis catus 99.73 0.00e+00 1517.00
IUUC-Fal-036751 Ficedula albicollis 99.73 0.00e+00 1519.00
IUUC-Fox-037857 Fusarium oxysporum 36.92 3.00e-137 482.00
IUUC-Fso-038163 Fusarium solani 36.73 4.00e-141 495.00
IUUC-Gmo-038830 Gadus morhua 96.88 0.00e+00 1523.00
IUUC-Ggr-039999 Gaeumannomyces graminis 33.76 8.00e-127 448.00
IUUC-Gga-040329 Gallus gallus 99.61 0.00e+00 1563.00
IUUC-Gac-041510 Gasterosteus aculeatus 96.51 0.00e+00 1520.00
IUUC-Gma-043659 Glycine max 52.34 0.00e+00 746.00
IUUC-Ggo-044903 Gorilla gorilla 99.87 0.00e+00 1517.00
IUUC-Hvu-047831 Hordeum vulgare 52.60 0.00e+00 701.00
IUUC-Itr-049067 Ictidomys tridecemlineatus 99.78 0.00e+00 939.00
IUUC-Kpa-049372 Komagataella pastoris 34.94 9.00e-115 407.00
IUUC-Lch-050458 Latimeria chalumnae 97.39 0.00e+00 1520.00
IUUC-Lpe-051396 Leersia perrieri 51.63 0.00e+00 754.00
IUUC-Loc-052186 Lepisosteus oculatus 98.57 0.00e+00 1550.00
IUUC-Lma-053030 Leptosphaeria maculans 38.55 7.00e-144 504.00
IUUC-Laf-053684 Loxodonta africana 99.73 0.00e+00 1517.00
IUUC-Mcc-055770 Macaca mulatta 100.00 0.00e+00 1568.00
IUUC-Meu-056852 Macropus eugenii 100.00 0.00e+00 764.00
IUUC-Mor-057273 Magnaporthe oryzae 34.63 5.00e-132 465.00
IUUC-Mpo-057403 Magnaporthe poae 33.89 1.00e-128 454.00
IUUC-Mtr-058317 Medicago truncatula 51.84 0.00e+00 754.00
IUUC-Mla-059055 Melampsora laricipopulina 37.66 4.00e-133 468.00
IUUC-Mga-060076 Meleagris gallopavo 97.99 0.00e+00 1485.00
IUUC-Mvi-060470 Microbotryum violaceum 33.64 4.00e-135 476.00
IUUC-Mmr-060976 Microcebus murinus 99.74 0.00e+00 1564.00
IUUC-Mdo-062741 Monodelphis domestica 99.74 0.00e+00 1564.00
IUUC-Mmu-063905 Mus musculus 99.48 0.00e+00 1560.00
IUUC-Mac-064718 Musa acuminata 50.79 0.00e+00 730.00
IUUC-Mpu-066356 Mustela putorius furo 99.73 0.00e+00 1517.00
IUUC-Mlu-067768 Myotis lucifugus 99.20 0.00e+00 1514.00
IUUC-Nfi-068285 Neosartorya fischeri 37.20 1.00e-145 510.00
IUUC-Ncr-068883 Neurospora crassa 36.28 4.00e-138 485.00
IUUC-Nle-069638 Nomascus leucogenys 100.00 0.00e+00 1521.00
IUUC-Opr-070333 Ochotona princeps 90.61 0.00e+00 1267.00
IUUC-Ont-071601 Oreochromis niloticus 97.79 0.00e+00 1568.00
IUUC-Oan-073281 Ornithorhynchus anatinus 99.52 0.00e+00 1298.00
IUUC-Ocu-074504 Oryctolagus cuniculus 99.60 0.00e+00 1520.00
IUUC-Oba-075332 Oryza barthii 52.17 0.00e+00 748.00
IUUC-Obr-076790 Oryza brachyantha 49.21 0.00e+00 715.00
IUUC-Ogl-077655 Oryza glaberrima 52.16 0.00e+00 756.00
IUUC-Ogu-078458 Oryza glumaepatula 52.17 0.00e+00 748.00
IUUC-Oin-079567 Oryza indica 52.03 0.00e+00 754.00
IUUC-Olo-080930 Oryza longistaminata 52.89 0.00e+00 755.00
IUUC-Ome-081353 Oryza meridionalis 52.16 0.00e+00 756.00
IUUC-Oni-082378 Oryza nivara 52.16 0.00e+00 756.00
IUUC-Opu-084055 Oryza punctata 52.03 0.00e+00 756.00
IUUC-Oru-084202 Oryza rufipogon 52.17 0.00e+00 748.00
IUUC-Osa-085290 Oryza sativa 52.16 0.00e+00 757.00
IUUC-Ola-087562 Oryzias latipes 97.53 0.00e+00 1535.00
IUUC-Olu-087866 Ostreococcus lucimarinus 37.79 6.00e-140 491.00
IUUC-Oga-088833 Otolemur garnettii 99.73 0.00e+00 1517.00
IUUC-Oar-089958 Ovis aries 99.73 0.00e+00 1517.00
IUUC-Ptr-091013 Pan troglodytes 100.00 0.00e+00 1568.00
IUUC-Pan-091796 Papio anubis 99.33 0.00e+00 1512.00
IUUC-Psi-093564 Pelodiscus sinensis 97.99 0.00e+00 1483.00
IUUC-Pno-094939 Phaeosphaeria nodorum 38.22 5.00e-139 488.00
IUUC-Ppa-095920 Physcomitrella patens 51.84 0.00e+00 765.00
IUUC-Pfo-097498 Poecilia formosa 93.39 0.00e+00 1515.00
IUUC-Pab-098164 Pongo abelii 100.00 0.00e+00 1568.00
IUUC-Pop-099497 Populus trichocarpa 53.34 0.00e+00 790.00
IUUC-Pca-100702 Procavia capensis 91.67 0.00e+00 1391.00
IUUC-Ppe-101971 Prunus persica 51.96 0.00e+00 738.00
IUUC-Pva-103129 Pteropus vampyrus 99.61 0.00e+00 1563.00
IUUC-Pgr-103684 Puccinia graminis 36.44 6.00e-110 392.00
IUUC-Ptt-103961 Puccinia triticina 36.62 4.00e-109 389.00
IUUC-Pte-104325 Pyrenophora teres 37.94 1.00e-134 474.00
IUUC-Pyt-104746 Pyrenophora triticirepentis 36.97 1.00e-132 467.00
IUUC-Rno-105935 Rattus norvegicus 99.60 0.00e+00 1516.00
IUUC-Sce-106354 Saccharomyces cerevisiae 26.59 2.00e-52 200.00
IUUC-Sha-106569 Sarcophilus harrisii 99.12 0.00e+00 1382.00
IUUC-Sja-107676 Schizosaccharomyces japonicus 38.51 2.00e-154 539.00
IUUC-Spo-108135 Schizosaccharomyces pombe 37.48 4.00e-138 485.00
IUUC-Smo-109555 Selaginella moellendorffii 53.35 0.00e+00 786.00
IUUC-Sit-110763 Setaria italica 53.07 0.00e+00 765.00
IUUC-Sly-111090 Solanum lycopersicum 52.11 0.00e+00 766.00
IUUC-Stu-112351 Solanum tuberosum 52.24 0.00e+00 768.00
IUUC-Sar-113144 Sorex araneus 99.63 0.00e+00 1114.00
IUUC-Sbi-114690 Sorghum bicolor 52.29 0.00e+00 766.00
IUUC-Sre-115005 Sporisorium reilianum 37.90 2.00e-134 473.00
IUUC-Ssc-116053 Sus scrofa 99.45 0.00e+00 1139.00
IUUC-Tgu-116523 Taeniopygia guttata 99.73 0.00e+00 1517.00
IUUC-Tru-118189 Takifugu rubripes 93.88 0.00e+00 1444.00
IUUC-Tsy-118962 Tarsius syrichta 93.41 0.00e+00 1385.00
IUUC-Tni-120614 Tetraodon nigroviridis 57.09 0.00e+00 876.00
IUUC-Tca-121282 Theobroma cacao 52.81 0.00e+00 771.00
IUUC-Tre-122201 Trichoderma reesei 35.76 6.00e-133 468.00
IUUC-Tvi-122321 Trichoderma virens 36.36 4.00e-134 472.00
IUUC-Tae-124292 Triticum aestivum 52.03 0.00e+00 745.00
IUUC-Tur-126800 Triticum urartu 51.76 0.00e+00 741.00
IUUC-Tme-127053 Tuber melanosporum 40.48 1.00e-155 543.00
IUUC-Tbe-127427 Tupaia belangeri 84.92 0.00e+00 1160.00
IUUC-Ttr-128662 Tursiops truncatus 97.99 0.00e+00 1477.00
IUUC-Uma-129597 Ustilago maydis 38.26 2.00e-133 469.00
IUUC-Vda-129726 Verticillium dahliae 35.26 2.00e-133 469.00
IUUC-Vpa-130809 Vicugna pacos 99.46 0.00e+00 741.00
IUUC-Vvi-131630 Vitis vinifera 52.68 0.00e+00 760.00
IUUC-Xtr-131887 Xenopus tropicalis 98.44 0.00e+00 1544.00
IUUC-Xma-133517 Xiphophorus maculatus 97.66 0.00e+00 1538.00
IUUC-Yli-134576 Yarrowia lipolytica 33.46 4.00e-111 395.00
IUUC-Zma-135030 Zea mays 52.73 0.00e+00 772.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved