• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • dbPAF
    • dbPTM
    • Phospho.ELM
    • PHOSIDA
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bta-013357
UUCD1 version UUC-BoT-00822
Ensembl Protein ID ENSBTAP00000026183.3
UniProt Accession P63243; P25388; P99049; Q3T0R8; RACK1_BOVIN
Genbank Protein ID CAB64792.1; AAI02287.2
Protein Name Receptor of activated protein C kinase 1; Guanine nucleotide-binding protein subunit beta-2-like 1; Receptor for activated C kinase; Receptor of activated protein kinase C 1; Receptor of activated protein C kinase 1, N-terminally processed
Genbank Nucleotide ID AJ132860; BC102286
Gene Name RACK1; GNB2L1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000019648.3 ENSBTAT00000026183.3 ENSBTAP00000026183.3
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/DCX/DWD 1.90e-44 147.8 103 133
UBD/Beta-Prp 1.80e-54 185.1 10 160
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/DCX/DWD

   S: 1    gHtdsvtclaf.sd.tllvsGsdDgtikvWD 29
    gHt +v ++af sd + +vsGs+D+tik+W+
   Q: 103 GHTKDVLSVAFsSDnRQIVSGSRDKTIKLWN 133
    8***********88899*************9 PP
   


   UBD/Beta-Prp

   S: 89   tlkghedsvlslsfspsg.dklvsGshdrtirvwdletgqclee....tlsghdgvvncvvvhpdgnllvsGslDrtvrlWdlktgkll 172
    tlkgh+ v+ ++ p+ d ++s+s+d+ti +w+l ++ + l+gh+++v+ vv+++dg+ sGs D+t+rlWdl tg+
   Q: 10 TLKGHNGWVTQIATTPQFpDMILSASRDKTIIMWKLTRDETNYGipqrALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTT 98
    78999999999999998889999999999999999876666555666899999999999999999999999999999999999999999 PP
   S: 173 rtltgghtdsvyslsfdsngkelvsgsldgtvklwdlqtgecvrtlng..htdnvksvrfspnd 234
    r++ g ht++v s++f+s+ +++vsgs+d+t+klw+ g c +t+++ h+++v++vrfspn+
   Q: 99 RRFVG-HTKDVLSVAFSSDNRQIVSGSRDKTIKLWNT-LGVCKYTVQDesHSEWVSCVRFSPNS 160
    99998.9999999999999999999999999999998.67788887766699999999999887 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     Involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Interacts with a wide variety of proteins and plays a role in many cellular processes. Component of the 40S ribosomal subunit involved in translational repression (By similarity). Involved in the initiation of the ribosome quality control (RQC), a pathway that takes place when a ribosome has stalled during translation, by promoting ubiquitination of a subset of 40S ribosomal subunits (By similarity). Binds to and stabilizes activated protein kinase C (PKC), increasing PKC-mediated phosphorylation. May recruit activated PKC to the ribosome, leading to phosphorylation of EIF6. Inhibits the activity of SRC kinases including SRC, LCK and YES1. Inhibits cell growth by prolonging the G0/G1 phase of the cell cycle. Enhances phosphorylation of BMAL1 by PRKCA and inhibits transcriptional activity of the BMAL1-CLOCK heterodimer. Facilitates ligand-independent nuclear translocation of AR following PKC activation, represses AR transactivation activity and is required for phosphorylation of AR by SRC. Modulates IGF1R-dependent integrin signaling and promotes cell spreading and contact with the extracellular matrix. Involved in PKC-dependent translocation of ADAM12 to the cell membrane. Promotes the ubiquitination and proteasome-mediated degradation of proteins such as CLEC1B and HIF1A. Required for VANGL2 membrane localization, inhibits Wnt signaling, and regulates cellular polarization and oriented cell division during gastrulation. Required for PTK2/FAK1 phosphorylation and dephosphorylation. Regulates internalization of the muscarinic receptor CHRM2. Promotes apoptosis by increasing oligomerization of BAX and disrupting the interaction of BAX with the anti-apoptotic factor BCL2L. Inhibits TRPM6 channel activity. Regulates cell surface expression of some GPCRs such as TBXA2R. Plays a role in regulation of FLT1-mediated cell migration (By similarity). Involved in the transport of ABCB4 from the Golgi to the apical bile canalicular membrane (By similarity).
Involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Interacts with a wide variety of proteins and plays a role in many cellular processes. Component of the 40S ribosomal subunit involved in translational repression (By similarity). Involved in the initiation of the ribosome quality control (RQC), a pathway that takes place when a ribosome has stalled during translation, by promoting ubiquitination of a subset of 40S ribosomal subunits (By similarity). Binds to and stabilizes activated protein kinase C (PKC), increasing PKC-mediated phosphorylation. May recruit activated PKC to the ribosome, leading to phosphorylation of EIF6. Inhibits the activity of SRC kinases including SRC, LCK and YES1. Inhibits cell growth by prolonging the G0/G1 phase of the cell cycle. Enhances phosphorylation of BMAL1 by PRKCA and inhibits transcriptional activity of the BMAL1-CLOCK heterodimer. Facilitates ligand-independent nuclear translocation of AR following PKC activation, represses AR transactivation activity and is required for phosphorylation of AR by SRC. Modulates IGF1R-dependent integrin signaling and promotes cell spreading and contact with the extracellular matrix. Involved in PKC-dependent translocation of ADAM12 to the cell membrane. Promotes the ubiquitination and proteasome-mediated degradation of proteins such as CLEC1B and HIF1A. Required for VANGL2 membrane localization, inhibits Wnt signaling, and regulates cellular polarization and oriented cell division during gastrulation. Required for PTK2/FAK1 phosphorylation and dephosphorylation. Regulates internalization of the muscarinic receptor CHRM2. Promotes apoptosis by increasing oligomerization of BAX and disrupting the interaction of BAX with the anti-apoptotic factor BCL2L. Inhibits TRPM6 channel activity. Regulates cell surface expression of some GPCRs such as TBXA2R. Plays a role in regulation of FLT1-mediated cell migration (By similarity). Involved in the transport of ABCB4 from the Golgi to the apical bile canalicular membrane (By similarity).
Protein Sequence
(Fasta)
MTEQMTLRGT LKGHNGWVTQ IATTPQFPDM ILSASRDKTI IMWKLTRDET NYGIPQRALR 60
GHSHFVSDVV ISSDGQFALS GSWDGTLRLW DLTTGTTTRR FVGHTKDVLS VAFSSDNRQI 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-013357|E3,WD_repeat;UBD,Beta-Prp|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TTTTCCTCTG CAGGGCCGCG GTGGAAGCGG GTGCGCGGGT CGCCTCTCTG AGTTATCCAG 60
TTCCATCCTT GTCGCTGCGG CGACACCCGC ATTCTCCGTC GCCATGACTG AACAGATGAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-013357|E3,WD_repeat;UBD,Beta-Prp|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0007--Acetylation
KW-0053--Apoptosis
KW-0090--Biological rhythms
KW-0131--Cell cycle
KW-1003--Cell membrane
KW-0966--Cell projection
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0217--Developmental protein
KW-0306--Gastrulation
KW-0341--Growth regulation
KW-0472--Membrane
KW-0539--Nucleus
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0677--Repeat
KW-0687--Ribonucleoprotein
KW-0689--Ribosomal protein
KW-0810--Translation regulation
KW-0853--WD repeat

Interpro

IPR020472--G-protein_beta_WD-40_rep
IPR015943--WD40/YVTN_repeat-like_dom
IPR001680--WD40_repeat
IPR019775--WD40_repeat_CS
IPR017986--WD40_repeat_dom

PROSITE

PS00678--WD_REPEATS_1
PS50082--WD_REPEATS_2
PS50294--WD_REPEATS_REGION

Pfam

PF00400--WD40

PRINTS

PR00320--GPROTEINBRPT

SMART

SM00320--WD40

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0030425--C:dendrite
GO:0070062--C:extracellular exosome
GO:1990630--C:IRE1-RACK1-PP2A complex
GO:0030496--C:midbody
GO:0005739--C:mitochondrion
GO:0043025--C:neuronal cell body
GO:0005654--C:nucleoplasm
GO:0005634--C:nucleus
GO:0043204--C:perikaryon
GO:0048471--C:perinuclear region of cytoplasm
GO:0001891--C:phagocytic cup
GO:0008656--F:cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0008200--F:ion channel inhibitor activity
GO:0005080--F:protein kinase C binding
GO:0030292--F:protein tyrosine kinase inhibitor activity
GO:0030971--F:receptor tyrosine kinase binding
GO:0003723--F:RNA binding
GO:0042169--F:SH2 domain binding
GO:0035591--F:signaling adaptor activity
GO:0007049--P:cell cycle
GO:0071333--P:cellular response to glucose stimulus
GO:0071363--P:cellular response to growth factor stimulus
GO:0007369--P:gastrulation
GO:0030308--P:negative regulation of cell growth
GO:0010629--P:negative regulation of gene expression
GO:1903208--P:negative regulation of hydrogen peroxide-induced neuron death
GO:0033137--P:negative regulation of peptidyl-serine phosphorylation
GO:0050765--P:negative regulation of phagocytosis
GO:0051898--P:negative regulation of protein kinase B signaling
GO:0030178--P:negative regulation of Wnt signaling pathway
GO:0043473--P:pigmentation
GO:0043065--P:positive regulation of apoptotic process
GO:0030822--P:positive regulation of cAMP catabolic process
GO:0030335--P:positive regulation of cell migration
GO:0051343--P:positive regulation of cyclic-nucleotide phosphodiesterase activity
GO:2000543--P:positive regulation of gastrulation
GO:0042998--P:positive regulation of Golgi to plasma membrane protein transport
GO:0043547--P:positive regulation of GTPase activity
GO:2001244--P:positive regulation of intrinsic apoptotic signaling pathway
GO:0051901--P:positive regulation of mitochondrial depolarization
GO:0032436--P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032464--P:positive regulation of protein homooligomerization
GO:0001934--P:positive regulation of protein phosphorylation
GO:0051726--P:regulation of cell cycle
GO:0051302--P:regulation of cell division
GO:2000114--P:regulation of establishment of cell polarity
GO:0032880--P:regulation of protein localization
GO:0006417--P:regulation of translation
GO:0048511--P:rhythmic process
GO:0006412--P:translation

KEGG bta:327682
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000395 Aegilops tauschii 64.44 7.00e-103 366.00
IUUC-Aml-001935 Ailuropoda melanoleuca 100.00 0.00e+00 653.00
IUUC-Atr-002694 Amborella trichopoda 67.73 5.00e-125 440.00
IUUC-Apl-003918 Anas platyrhynchos 100.00 2.00e-166 577.00
IUUC-Aca-004869 Anolis carolinensis 100.00 0.00e+00 653.00
IUUC-Aly-005671 Arabidopsis lyrata 65.43 6.00e-125 439.00
IUUC-Ath-007105 Arabidopsis thaliana 66.25 3.00e-125 441.00
IUUC-Ago-007720 Ashbya gossypii 56.23 2.00e-102 365.00
IUUC-Acl-008156 Aspergillus clavatus 72.44 3.00e-138 484.00
IUUC-Afl-008684 Aspergillus flavus 71.47 4.00e-137 480.00
IUUC-Afu-008867 Aspergillus fumigatus 73.40 1.00e-139 489.00
IUUC-Ani-009221 Aspergillus nidulans 72.44 3.00e-138 484.00
IUUC-Ang-009843 Aspergillus niger 71.47 1.00e-136 478.00
IUUC-Aor-010193 Aspergillus oryzae 71.47 4.00e-137 480.00
IUUC-Ate-010420 Aspergillus terreus 72.44 2.00e-124 438.00
IUUC-Ame-010884 Astyanax mexicanus 96.53 0.00e+00 640.00
IUUC-Bgr-012064 Blumeria graminis 70.19 7.00e-135 473.00
IUUC-Bci-013862 Botrytis cinerea 71.15 3.00e-137 481.00
IUUC-Bdi-014690 Brachypodium distachyon 62.39 6.00e-114 403.00
IUUC-Bol-016231 Brassica oleracea 66.56 9.00e-127 446.00
IUUC-Bra-016879 Brassica rapa 66.15 3.00e-125 441.00
IUUC-Cel-018335 Caenorhabditis elegans 69.06 3.00e-123 434.00
IUUC-Cja-019914 Callithrix jacchus 100.00 0.00e+00 653.00
IUUC-Cfa-020755 Canis familiaris 100.00 0.00e+00 653.00
IUUC-Cpo-022377 Cavia porcellus 100.00 0.00e+00 654.00
IUUC-Cre-022909 Chlamydomonas reinhardtii 74.60 5.00e-137 480.00
IUUC-Csa-023025 Chlorocebus sabaeus 100.00 0.00e+00 652.00
IUUC-Cin-025647 Ciona intestinalis 77.07 2.00e-146 511.00
IUUC-Csv-026027 Ciona savignyi 76.75 2.00e-144 504.00
IUUC-Cgl-026718 Colletotrichum gloeosporioides 74.91 4.00e-129 453.00
IUUC-Cne-026930 Cryptococcus neoformans 71.15 9.00e-137 479.00
IUUC-Cme-027251 Cyanidioschyzon merolae 63.46 6.00e-122 429.00
IUUC-Dre-028669 Danio rerio 95.58 0.00e+00 636.00
IUUC-Dno-029470 Dasypus novemcinctus 84.54 5.00e-149 520.00
IUUC-Dor-031098 Dipodomys ordii 89.91 2.00e-149 521.00
IUUC-Dse-031255 Dothistroma septosporum 71.15 7.00e-137 479.00
IUUC-Dme-032118 Drosophila melanogaster 77.14 1.00e-147 515.00
IUUC-Ete-033182 Echinops telfairi 83.41 1.00e-105 375.00
IUUC-Eca-033296 Equus caballus 100.00 3.00e-87 313.00
IUUC-Eeu-034771 Erinaceus europaeus 94.64 2.00e-176 611.00
IUUC-Fca-036315 Felis catus 100.00 0.00e+00 653.00
IUUC-Fal-036990 Ficedula albicollis 97.22 3.00e-103 367.00
IUUC-Fox-037702 Fusarium oxysporum 72.44 2.00e-139 488.00
IUUC-Fso-038384 Fusarium solani 73.08 1.00e-139 489.00
IUUC-Gmo-039630 Gadus morhua 94.16 2.00e-176 611.00
IUUC-Ggr-039985 Gaeumannomyces graminis 72.76 1.00e-139 488.00
IUUC-Gga-040540 Gallus gallus 100.00 0.00e+00 653.00
IUUC-Gac-041316 Gasterosteus aculeatus 91.32 5.00e-174 603.00
IUUC-Gma-042872 Glycine max 66.46 1.00e-125 442.00
IUUC-Ggo-045253 Gorilla gorilla 100.00 0.00e+00 653.00
IUUC-Hsa-046809 Homo sapiens 100.00 0.00e+00 653.00
IUUC-Hvu-047683 Hordeum vulgare 63.22 2.00e-115 409.00
IUUC-Itr-048025 Ictidomys tridecemlineatus 100.00 0.00e+00 653.00
IUUC-Kpa-049214 Komagataella pastoris 58.06 9.00e-100 356.00
IUUC-Lch-049634 Latimeria chalumnae 94.32 0.00e+00 628.00
IUUC-Lpe-050762 Leersia perrieri 62.88 1.00e-114 405.00
IUUC-Loc-052163 Lepisosteus oculatus 97.16 0.00e+00 644.00
IUUC-Lma-053113 Leptosphaeria maculans 72.76 3.00e-139 487.00
IUUC-Laf-054422 Loxodonta africana 100.00 0.00e+00 653.00
IUUC-Mcc-055348 Macaca mulatta 100.00 0.00e+00 652.00
IUUC-Meu-056543 Macropus eugenii 100.00 0.00e+00 653.00
IUUC-Mor-057107 Magnaporthe oryzae 72.76 2.00e-140 491.00
IUUC-Mpo-057487 Magnaporthe poae 73.08 3.00e-140 490.00
IUUC-Mtr-058808 Medicago truncatula 66.77 4.00e-126 444.00
IUUC-Mla-058909 Melampsora laricipopulina 73.16 3.00e-139 487.00
IUUC-Mga-059387 Meleagris gallopavo 100.00 0.00e+00 653.00
IUUC-Mvi-060392 Microbotryum violaceum 69.23 3.00e-134 470.00
IUUC-Mmr-061141 Microcebus murinus 89.27 5.00e-139 486.00
IUUC-Mdo-062932 Monodelphis domestica 100.00 0.00e+00 653.00
IUUC-Mmu-064132 Mus musculus 100.00 0.00e+00 653.00
IUUC-Mac-064447 Musa acuminata 61.11 5.00e-109 387.00
IUUC-Mpu-066721 Mustela putorius furo 99.05 0.00e+00 641.00
IUUC-Mlu-068221 Myotis lucifugus 99.37 8.00e-177 612.00
IUUC-Nfi-068344 Neosartorya fischeri 73.40 1.00e-139 489.00
IUUC-Ncr-068722 Neurospora crassa 71.47 2.00e-137 481.00
IUUC-Nle-069865 Nomascus leucogenys 100.00 0.00e+00 653.00
IUUC-Opr-071100 Ochotona princeps 84.86 6.00e-152 530.00
IUUC-Ont-072287 Oreochromis niloticus 94.32 0.00e+00 631.00
IUUC-Oan-072788 Ornithorhynchus anatinus 100.00 0.00e+00 653.00
IUUC-Ocu-073844 Oryctolagus cuniculus 97.48 0.00e+00 630.00
IUUC-Oba-075981 Oryza barthii 59.94 4.00e-103 367.00
IUUC-Obr-076099 Oryza brachyantha 61.47 2.00e-113 401.00
IUUC-Ogl-077804 Oryza glaberrima 62.69 2.00e-115 408.00
IUUC-Ogu-078035 Oryza glumaepatula 63.38 8.00e-115 406.00
IUUC-Oin-079327 Oryza indica 63.38 8.00e-115 406.00
IUUC-Olo-081084 Oryza longistaminata 63.38 8.00e-115 406.00
IUUC-Ome-081366 Oryza meridionalis 63.00 8.00e-116 409.00
IUUC-Oni-082682 Oryza nivara 63.00 8.00e-116 409.00
IUUC-Opu-084010 Oryza punctata 62.69 6.00e-116 410.00
IUUC-Oru-084358 Oryza rufipogon 63.00 8.00e-116 409.00
IUUC-Osa-085296 Oryza sativa 63.00 8.00e-116 409.00
IUUC-Ola-086400 Oryzias latipes 94.01 0.00e+00 630.00
IUUC-Olu-087817 Ostreococcus lucimarinus 75.79 3.00e-142 497.00
IUUC-Oga-088811 Otolemur garnettii 100.00 0.00e+00 653.00
IUUC-Oar-089962 Ovis aries 100.00 0.00e+00 653.00
IUUC-Ptr-091340 Pan troglodytes 100.00 0.00e+00 653.00
IUUC-Pan-091946 Papio anubis 100.00 0.00e+00 652.00
IUUC-Pma-094535 Petromyzon marinus 94.01 0.00e+00 626.00
IUUC-Pno-095100 Phaeosphaeria nodorum 75.00 7.00e-97 346.00
IUUC-Ppa-095588 Physcomitrella patens 75.08 1.00e-139 489.00
IUUC-Pfo-097311 Poecilia formosa 94.01 0.00e+00 629.00
IUUC-Pab-097863 Pongo abelii 100.00 0.00e+00 653.00
IUUC-Pop-099345 Populus trichocarpa 67.80 9.00e-129 452.00
IUUC-Pca-100594 Procavia capensis 99.05 0.00e+00 647.00
IUUC-Ppe-101743 Prunus persica 65.12 3.00e-123 434.00
IUUC-Pva-102746 Pteropus vampyrus 83.91 3.00e-150 524.00
IUUC-Pgr-103375 Puccinia graminis 57.51 5.00e-97 347.00
IUUC-Ptt-103839 Puccinia triticina 73.16 9.00e-138 482.00
IUUC-Pte-104026 Pyrenophora teres 72.76 3.00e-139 487.00
IUUC-Pyt-104584 Pyrenophora triticirepentis 72.76 3.00e-139 487.00
IUUC-Rno-104964 Rattus norvegicus 100.00 0.00e+00 653.00
IUUC-Sce-106224 Saccharomyces cerevisiae 53.82 5.00e-97 347.00
IUUC-Sha-107409 Sarcophilus harrisii 100.00 0.00e+00 653.00
IUUC-Sja-107971 Schizosaccharomyces japonicus 65.81 2.00e-126 444.00
IUUC-Spo-108297 Schizosaccharomyces pombe 64.22 4.00e-123 433.00
IUUC-Ssl-108479 Sclerotinia sclerotiorum 71.15 3.00e-137 481.00
IUUC-Smo-109017 Selaginella moellendorffii 69.62 1.00e-128 452.00
IUUC-Sit-110680 Setaria italica 62.77 5.00e-115 407.00
IUUC-Sly-111496 Solanum lycopersicum 68.44 7.00e-127 446.00
IUUC-Stu-112757 Solanum tuberosum 66.88 1.00e-122 432.00
IUUC-Sar-113173 Sorex araneus 100.00 0.00e+00 653.00
IUUC-Sbi-114681 Sorghum bicolor 63.08 3.00e-116 411.00
IUUC-Sre-115107 Sporisorium reilianum 70.83 2.00e-138 485.00
IUUC-Ssc-116218 Sus scrofa 95.58 2.00e-180 624.00
IUUC-Tru-118202 Takifugu rubripes 92.74 1.00e-179 621.00
IUUC-Tni-120260 Tetraodon nigroviridis 92.43 5.00e-179 619.00
IUUC-Tca-120951 Theobroma cacao 66.15 7.00e-127 446.00
IUUC-Tre-121961 Trichoderma reesei 73.40 1.00e-140 492.00
IUUC-Tvi-122447 Trichoderma virens 73.08 1.00e-139 488.00
IUUC-Tae-123560 Triticum aestivum 62.61 2.00e-114 405.00
IUUC-Tur-126335 Triticum urartu 67.78 3.00e-104 371.00
IUUC-Tme-127105 Tuber melanosporum 67.96 1.00e-125 442.00
IUUC-Tbe-128021 Tupaia belangeri 79.70 3.00e-86 310.00
IUUC-Ttr-128637 Tursiops truncatus 88.33 5.00e-162 563.00
IUUC-Uma-129634 Ustilago maydis 71.79 1.00e-139 488.00
IUUC-Vda-129923 Verticillium dahliae 72.44 5.00e-139 486.00
IUUC-Vpa-130410 Vicugna pacos 77.61 5.00e-112 397.00
IUUC-Vvi-131115 Vitis vinifera 66.67 4.00e-127 447.00
IUUC-Xtr-132105 Xenopus tropicalis 96.21 0.00e+00 641.00
IUUC-Xma-133875 Xiphophorus maculatus 94.32 0.00e+00 630.00
IUUC-Yli-134624 Yarrowia lipolytica 60.76 3.00e-119 421.00
IUUC-Zma-134711 Zea mays 63.08 3.00e-115 407.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved