• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • miRTarBase
    • microRNA
    • RAID2
  • PPI
    • IID
    • Mentha
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Ome-081738
Ensembl Protein ID OMERI01G02960.2
UniProt Accession A0A0E0BX36; A0A0E0BX36_9ORYZ
Protein Name Uncharacterized protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
OMERI01G02960 OMERI01G02960.1 OMERI01G02960.1
OMERI01G02960 OMERI01G02960.2 OMERI01G02960.2
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/N-recognin/UBR-box 1.60e-19 71.1 121 188
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/N-recognin/UBR-box

   S: 2    lCgrvfkvgetiyeCrtCsvdetlvlCteCfakvvHkdHeyklkksggggfCdCGdteAwedgskCkkl 70
    Cg v+ +++ y+CrtC+ d+t+++C+ Cf++ HkdH+y++ +g gg+CdCGdt+Aw+ + +C +
   Q: 121 VCGSVWGQNDLAYRCRTCEHDPTCAICVPCFQNGNHKDHDYSIMYTG-GGCCDCGDTTAWKREGFCSRH 188
    6*****************************************97666.9*****************988 PP
   

Organism Oryza meridionalis
Protein Sequence
(Fasta)
MAGMDGGGGP SDAPPELSPQ ELIEQKLILF GVPQEQLQEH QEGLLIYLEE HKELIPEIAK 60
LVLSVGADLL EARKASNKDG DSSNSEACDE ILSWLQWLMF NNEPHAMLDD LERSTAGERA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ome-081738|E3,UBR-box|Oryza meridionalis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGGGTTTATT TGGGGGTTGG GGTGGTGGTG GTGATTCGAT TCAGCGAGGC TGGGGCGTGG 60
GGGCGGGCGA TCGGGTCACT GGAGTTGTCC CAGCTGGCTT CGGGCCATGG CTGGGATGGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ome-081738|E3,UBR-box|Oryza meridionalis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0472--Membrane
KW-0812--Transmembrane
KW-1133--Transmembrane helix

Interpro

IPR013083--Znf_RING/FYVE/PHD
IPR003126--Znf_UBR

PROSITE

PS51157--ZF_UBR

Pfam

PF02207--zf-UBR

SMART

SM00396--ZnF_UBR1

Gene Ontology

GO:0016021--C:integral component of membrane
GO:0004842--F:ubiquitin-protein transferase activity
GO:0008270--F:zinc ion binding
GO:0050994--P:regulation of lipid catabolic process
GO:0010029--P:regulation of seed germination
GO:0009737--P:response to abscisic acid
GO:0006511--P:ubiquitin-dependent protein catabolic process

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000949 Aegilops tauschii 68.41 0.00e+00 2201.00
IUUC-Aml-001876 Ailuropoda melanoleuca 24.56 3.00e-14 74.30
IUUC-Atr-002501 Amborella trichopoda 40.70 0.00e+00 832.00
IUUC-Apl-003828 Anas platyrhynchos 31.34 2.00e-17 85.10
IUUC-Aca-005189 Anolis carolinensis 39.58 1.00e-15 79.00
IUUC-Aly-005901 Arabidopsis lyrata 38.42 0.00e+00 1042.00
IUUC-Ath-007148 Arabidopsis thaliana 38.15 0.00e+00 1050.00
IUUC-Ago-007946 Ashbya gossypii 37.70 3.00e-09 57.80
IUUC-Acl-008055 Aspergillus clavatus 21.50 9.00e-08 53.10
IUUC-Afl-008479 Aspergillus flavus 21.31 3.00e-09 58.20
IUUC-Afu-008929 Aspergillus fumigatus 30.28 6.00e-10 60.50
IUUC-Ani-009334 Aspergillus nidulans 31.50 6.00e-16 80.50
IUUC-Ang-009550 Aspergillus niger 23.30 4.00e-10 61.20
IUUC-Aor-010124 Aspergillus oryzae 21.31 3.00e-09 58.20
IUUC-Ate-010550 Aspergillus terreus 22.82 1.00e-09 59.30
IUUC-Ame-011917 Astyanax mexicanus 40.00 5.00e-18 86.70
IUUC-Bgr-011999 Blumeria graminis 37.80 7.00e-13 70.10
IUUC-Bta-012768 Bos taurus 38.00 3.00e-17 84.30
IUUC-Bci-013834 Botrytis cinerea 35.19 4.00e-14 74.30
IUUC-Bdi-014635 Brachypodium distachyon 72.42 0.00e+00 2723.00
IUUC-Bol-015669 Brassica oleracea 38.33 0.00e+00 1132.00
IUUC-Bra-017776 Brassica rapa 38.56 0.00e+00 1169.00
IUUC-Cel-018476 Caenorhabditis elegans 31.25 1.00e-06 49.30
IUUC-Cja-019797 Callithrix jacchus 22.65 2.00e-13 71.60
IUUC-Cfa-020950 Canis familiaris 37.00 3.00e-17 84.30
IUUC-Cpo-022385 Cavia porcellus 37.00 3.00e-17 84.30
IUUC-Csa-024082 Chlorocebus sabaeus 37.00 3.00e-17 84.30
IUUC-Cho-024550 Choloepus hoffmanni 43.00 2.00e-21 97.80
IUUC-Cin-025110 Ciona intestinalis 33.33 3.00e-20 94.40
IUUC-Csv-026033 Ciona savignyi 51.56 1.00e-16 77.80
IUUC-Cgl-026605 Colletotrichum gloeosporioides 32.54 4.00e-15 77.40
IUUC-Cne-026823 Cryptococcus neoformans 31.31 4.00e-11 64.30
IUUC-Dre-028343 Danio rerio 33.55 1.00e-18 89.40
IUUC-Dno-029427 Dasypus novemcinctus 38.00 7.00e-14 73.20
IUUC-Dor-030207 Dipodomys ordii 21.98 1.00e-14 75.90
IUUC-Dse-031531 Dothistroma septosporum 35.96 5.00e-15 77.00
IUUC-Dme-032215 Drosophila melanogaster 42.86 9.00e-20 93.20
IUUC-Ete-033162 Echinops telfairi 23.13 3.00e-15 77.40
IUUC-Eca-033454 Equus caballus 35.00 3.00e-16 80.90
IUUC-Eeu-034664 Erinaceus europaeus 44.00 6.00e-22 100.00
IUUC-Fca-036588 Felis catus 37.00 3.00e-17 84.30
IUUC-Fal-036919 Ficedula albicollis 31.34 2.00e-17 85.10
IUUC-Fox-037984 Fusarium oxysporum 31.75 2.00e-14 75.50
IUUC-Fso-038463 Fusarium solani 30.16 5.00e-14 73.90
IUUC-Gmo-039698 Gadus morhua 35.71 3.00e-20 94.00
IUUC-Ggr-040070 Gaeumannomyces graminis 35.43 4.00e-15 77.40
IUUC-Gga-040486 Gallus gallus 42.71 4.00e-20 94.00
IUUC-Gac-042622 Gasterosteus aculeatus 34.65 1.00e-17 85.50
IUUC-Gma-043803 Glycine max 40.35 0.00e+00 1284.00
IUUC-Ggo-045583 Gorilla gorilla 37.00 2.00e-17 84.70
IUUC-Hsa-046343 Homo sapiens 37.00 3.00e-17 84.70
IUUC-Hvu-047707 Hordeum vulgare 71.69 0.00e+00 1898.00
IUUC-Itr-048410 Ictidomys tridecemlineatus 37.50 2.00e-22 101.00
IUUC-Kpa-049088 Komagataella pastoris 32.65 3.00e-11 64.70
IUUC-Lch-049904 Latimeria chalumnae 38.81 2.00e-19 91.70
IUUC-Lpe-051516 Leersia perrieri 84.20 0.00e+00 3380.00
IUUC-Loc-052818 Lepisosteus oculatus 31.58 6.00e-19 90.10
IUUC-Lma-053059 Leptosphaeria maculans 37.97 1.00e-13 72.80
IUUC-Laf-053857 Loxodonta africana 37.68 3.00e-22 101.00
IUUC-Mcc-055677 Macaca mulatta 37.00 3.00e-17 84.30
IUUC-Meu-056204 Macropus eugenii 45.71 3.00e-16 80.90
IUUC-Mor-057051 Magnaporthe oryzae 26.67 1.00e-08 56.20
IUUC-Mpo-057372 Magnaporthe poae 34.40 2.00e-15 78.60
IUUC-Mtr-058538 Medicago truncatula 41.36 0.00e+00 1269.00
IUUC-Mla-058963 Melampsora laricipopulina 22.60 4.00e-09 57.40
IUUC-Mga-059917 Meleagris gallopavo 42.71 4.00e-20 94.00
IUUC-Mvi-060535 Microbotryum violaceum 24.71 5.00e-08 53.90
IUUC-Mmr-060901 Microcebus murinus 37.00 3.00e-17 84.30
IUUC-Mdo-062014 Monodelphis domestica 36.36 9.00e-17 82.80
IUUC-Mmu-063699 Mus musculus 38.00 2.00e-17 85.10
IUUC-Mac-064773 Musa acuminata 50.00 0.00e+00 1667.00
IUUC-Mpu-066153 Mustela putorius furo 37.00 3.00e-17 84.30
IUUC-Mlu-068151 Myotis lucifugus 32.12 9.00e-18 86.30
IUUC-Nfi-068403 Neosartorya fischeri 28.17 2.00e-08 55.50
IUUC-Ncr-068864 Neurospora crassa 33.87 5.00e-17 84.00
IUUC-Nle-069529 Nomascus leucogenys 37.00 3.00e-17 84.30
IUUC-Opr-071107 Ochotona princeps 26.17 5.00e-11 63.50
IUUC-Ont-072189 Oreochromis niloticus 32.56 2.00e-15 78.20
IUUC-Oan-072893 Ornithorhynchus anatinus 36.36 9.00e-17 82.80
IUUC-Ocu-074082 Oryctolagus cuniculus 36.36 1.00e-16 82.00
IUUC-Oba-075295 Oryza barthii 94.15 0.00e+00 3613.00
IUUC-Obr-076117 Oryza brachyantha 84.30 0.00e+00 3306.00
IUUC-Ogl-077571 Oryza glaberrima 91.65 0.00e+00 3575.00
IUUC-Ogu-078497 Oryza glumaepatula 94.62 0.00e+00 3617.00
IUUC-Oin-079343 Oryza indica 92.81 0.00e+00 3534.00
IUUC-Olo-081056 Oryza longistaminata 92.87 0.00e+00 3548.00
IUUC-Oni-083099 Oryza nivara 93.90 0.00e+00 3601.00
IUUC-Opu-083202 Oryza punctata 87.78 0.00e+00 3452.00
IUUC-Oru-084471 Oryza rufipogon 93.95 0.00e+00 3601.00
IUUC-Osa-085336 Oryza sativa 90.31 0.00e+00 1637.00
IUUC-Ola-087460 Oryzias latipes 35.92 1.00e-16 82.00
IUUC-Oga-088432 Otolemur garnettii 37.00 3.00e-17 84.30
IUUC-Oar-089557 Ovis aries 37.50 2.00e-22 101.00
IUUC-Ptr-091180 Pan troglodytes 37.00 3.00e-17 84.30
IUUC-Pan-092375 Papio anubis 37.00 3.00e-17 84.30
IUUC-Psi-093049 Pelodiscus sinensis 36.00 2.00e-16 81.60
IUUC-Pma-094569 Petromyzon marinus 36.97 4.00e-18 84.70
IUUC-Pno-094877 Phaeosphaeria nodorum 39.24 3.00e-14 74.70
IUUC-Ppa-095715 Physcomitrella patens 30.98 2.00e-152 533.00
IUUC-Pfo-096524 Poecilia formosa 25.69 6.00e-16 80.10
IUUC-Pab-097989 Pongo abelii 37.00 3.00e-17 84.30
IUUC-Pop-099496 Populus trichocarpa 40.96 0.00e+00 850.00
IUUC-Pca-101009 Procavia capensis 38.68 7.00e-16 79.70
IUUC-Ppe-101802 Prunus persica 41.91 0.00e+00 1223.00
IUUC-Pva-102538 Pteropus vampyrus 23.53 6.00e-14 73.20
IUUC-Pgr-103372 Puccinia graminis 47.83 6.00e-07 50.40
IUUC-Ptt-103878 Puccinia triticina 47.83 4.00e-07 50.80
IUUC-Pte-104174 Pyrenophora teres 39.19 1.00e-13 72.80
IUUC-Pyt-104431 Pyrenophora triticirepentis 39.19 5.00e-14 73.90
IUUC-Rno-105567 Rattus norvegicus 38.38 2.00e-17 85.10
IUUC-Sce-106272 Saccharomyces cerevisiae 34.48 9.00e-09 56.20
IUUC-Sha-106980 Sarcophilus harrisii 36.00 7.00e-17 83.20
IUUC-Sja-108005 Schizosaccharomyces japonicus 42.72 4.00e-17 82.80
IUUC-Spo-108084 Schizosaccharomyces pombe 37.72 2.00e-16 81.60
IUUC-Smo-108719 Selaginella moellendorffii 32.89 5.00e-157 548.00
IUUC-Sit-110716 Setaria italica 73.34 0.00e+00 2805.00
IUUC-Sly-111286 Solanum lycopersicum 41.63 0.00e+00 1345.00
IUUC-Sar-113332 Sorex araneus 21.92 9.00e-15 75.90
IUUC-Sbi-114577 Sorghum bicolor 73.08 0.00e+00 2763.00
IUUC-Sre-115045 Sporisorium reilianum 23.58 1.00e-06 49.70
IUUC-Ssc-115525 Sus scrofa 38.00 6.00e-18 86.30
IUUC-Tgu-116943 Taeniopygia guttata 31.34 2.00e-17 85.10
IUUC-Tru-117673 Takifugu rubripes 23.15 6.00e-10 60.10
IUUC-Tsy-119032 Tarsius syrichta 23.57 3.00e-14 74.30
IUUC-Tni-119987 Tetraodon nigroviridis 35.58 2.00e-17 85.10
IUUC-Tca-121077 Theobroma cacao 42.38 0.00e+00 1387.00
IUUC-Tre-122137 Trichoderma reesei 34.83 1.00e-13 72.80
IUUC-Tvi-122272 Trichoderma virens 34.78 2.00e-15 78.60
IUUC-Tae-125358 Triticum aestivum 70.71 0.00e+00 2641.00
IUUC-Tur-126562 Triticum urartu 62.81 0.00e+00 1417.00
IUUC-Tme-127156 Tuber melanosporum 37.00 2.00e-14 75.10
IUUC-Tbe-128088 Tupaia belangeri 40.85 3.00e-12 67.80
IUUC-Ttr-128253 Tursiops truncatus 38.00 9.00e-18 85.90
IUUC-Uma-129344 Ustilago maydis 42.25 1.00e-15 79.70
IUUC-Vda-129778 Verticillium dahliae 33.60 9.00e-16 79.70
IUUC-Vpa-130540 Vicugna pacos 38.00 2.00e-17 85.10
IUUC-Vvi-131290 Vitis vinifera 39.42 0.00e+00 1001.00
IUUC-Xtr-132690 Xenopus tropicalis 34.34 2.00e-15 78.60
IUUC-Xma-133748 Xiphophorus maculatus 26.15 1.00e-15 79.00
IUUC-Yli-134662 Yarrowia lipolytica 29.17 4.00e-12 67.40
IUUC-Zma-135553 Zea mays 73.55 0.00e+00 2754.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved