• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPTM
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Ncr-068894
Ensembl Protein ID EAA27012
UniProt Accession Q8WZY7; Q1K4Y7; ATG8_NEUCR
Genbank Protein ID CAD21230.1; EAA27012.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier atg8
Genbank Nucleotide ID AL670002; CM002237
Gene Name atg-8; apg-6; atg8; B24G3.150; NCU01545
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
NCU01545 EAA27012 EAA27012
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 7.50e-48 160.1 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayasee 101
    krk+e+e+ir+k+ d+iPvi+ek +k++i+++dkkkylvP+dltvgq+v++irkr++l +e+a+f++v+++l++++a +++iyee+kdedgfly++y++e+
   Q: 13 KRKAEAERIRQKYSDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGEN 113
    699************************************************************************************************** PP
   S: 102 tfG 104
    tfG
   Q: 114 TFG 116
    **9 PP
   

Organism Neurospora crassa
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With cpr-1/atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The apg-6/atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Ubiquitin-like modifier involved in autophagosomes formation. With cpr-1/atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The apg-6/atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MRSKFKDEHP FEKRKAEAER IRQKYSDRIP VICEKVEKSD IATIDKKKYL VPADLTVGQF 60
VYVIRKRIKL SPEKAIFIFV DEVLPPTAAL MSSIYEEHKD EDGFLYITYS GENTFGDFET 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ncr-068894|ULD,ATG8|Neurospora crassa
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTTACATCGA TGGTCAAAGA GGTACATCAA CCCTTCTTCC CCCTCTTCAT CCTCTTGCCG 60
TTTCTTACCT CTGACATCTC TCCCCAGCTT CCTCATTTCA TCACACGCCA GTCATCAAGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ncr-068894|ULD,ATG8|Neurospora crassa
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0015031--P:protein transport

KEGG ncr:NCU01545
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 77.39 7.00e-52 193.00
IUUC-Aml-001323 Ailuropoda melanoleuca 59.48 2.00e-39 151.00
IUUC-Atr-002791 Amborella trichopoda 82.61 8.00e-53 196.00
IUUC-Apl-003994 Anas platyrhynchos 55.17 2.00e-37 145.00
IUUC-Aca-005288 Anolis carolinensis 58.62 5.00e-39 150.00
IUUC-Aly-005987 Arabidopsis lyrata 81.03 3.00e-53 198.00
IUUC-Ath-006958 Arabidopsis thaliana 82.61 4.00e-45 171.00
IUUC-Ago-007898 Ashbya gossypii 71.19 1.00e-48 182.00
IUUC-Acl-008314 Aspergillus clavatus 99.15 8.00e-65 236.00
IUUC-Afl-008708 Aspergillus flavus 98.31 5.00e-65 236.00
IUUC-Afu-009097 Aspergillus fumigatus 99.15 8.00e-65 236.00
IUUC-Ani-009196 Aspergillus nidulans 98.29 4.00e-64 233.00
IUUC-Ang-009530 Aspergillus niger 99.15 8.00e-65 236.00
IUUC-Aor-009909 Aspergillus oryzae 98.31 5.00e-65 236.00
IUUC-Ate-010358 Aspergillus terreus 99.15 8.00e-65 236.00
IUUC-Ame-010914 Astyanax mexicanus 58.97 1.00e-39 152.00
IUUC-Bgr-012248 Blumeria graminis 97.41 4.00e-63 231.00
IUUC-Bta-012805 Bos taurus 59.48 2.00e-39 151.00
IUUC-Bci-013959 Botrytis cinerea 96.58 7.00e-64 233.00
IUUC-Bdi-014390 Brachypodium distachyon 82.61 2.00e-52 195.00
IUUC-Bol-016488 Brassica oleracea 83.48 3.00e-53 197.00
IUUC-Bra-016921 Brassica rapa 81.03 3.00e-53 197.00
IUUC-Cel-018200 Caenorhabditis elegans 56.90 4.00e-37 144.00
IUUC-Cja-019369 Callithrix jacchus 59.48 2.00e-39 151.00
IUUC-Cfa-020603 Canis familiaris 59.48 2.00e-39 151.00
IUUC-Cpo-021831 Cavia porcellus 58.62 6.00e-39 150.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 84.82 7.00e-46 174.00
IUUC-Csa-024117 Chlorocebus sabaeus 59.48 2.00e-39 151.00
IUUC-Cho-025008 Choloepus hoffmanni 51.72 6.00e-35 137.00
IUUC-Cin-025297 Ciona intestinalis 57.76 3.00e-39 151.00
IUUC-Csv-026146 Ciona savignyi 37.61 3.00e-21 91.70
IUUC-Cgl-026691 Colletotrichum gloeosporioides 72.73 4.00e-60 221.00
IUUC-Cne-026889 Cryptococcus neoformans 88.24 5.00e-60 220.00
IUUC-Cme-027158 Cyanidioschyzon merolae 27.50 9.90e-01 25.00
IUUC-Dre-027910 Danio rerio 59.83 7.00e-40 153.00
IUUC-Dno-029331 Dasypus novemcinctus 58.62 5.00e-39 150.00
IUUC-Dor-030245 Dipodomys ordii 59.48 2.00e-39 151.00
IUUC-Dse-031428 Dothistroma septosporum 98.29 1.00e-64 235.00
IUUC-Dme-031813 Drosophila melanogaster 61.21 5.00e-41 157.00
IUUC-Ete-032671 Echinops telfairi 59.48 2.00e-39 152.00
IUUC-Eca-034113 Equus caballus 58.62 8.00e-39 150.00
IUUC-Eeu-035131 Erinaceus europaeus 58.14 1.00e-26 108.00
IUUC-Fca-036493 Felis catus 59.48 3.00e-39 151.00
IUUC-Fal-036896 Ficedula albicollis 58.62 8.00e-39 150.00
IUUC-Fox-037846 Fusarium oxysporum 100.00 3.00e-65 238.00
IUUC-Fso-038134 Fusarium solani 99.15 6.00e-65 236.00
IUUC-Gmo-039671 Gadus morhua 58.97 1.00e-39 153.00
IUUC-Ggr-039770 Gaeumannomyces graminis 94.26 9.00e-63 229.00
IUUC-Gga-040257 Gallus gallus 59.48 1.00e-39 152.00
IUUC-Gac-041604 Gasterosteus aculeatus 59.48 4.00e-40 154.00
IUUC-Gma-044021 Glycine max 80.00 9.00e-53 196.00
IUUC-Ggo-044860 Gorilla gorilla 59.48 3.00e-39 151.00
IUUC-Hsa-045905 Homo sapiens 59.48 2.00e-39 151.00
IUUC-Hvu-047588 Hordeum vulgare 79.83 5.00e-53 197.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 59.48 2.00e-39 151.00
IUUC-Kpa-049124 Komagataella pastoris 82.91 1.00e-55 206.00
IUUC-Lch-049542 Latimeria chalumnae 57.76 5.00e-39 150.00
IUUC-Lpe-051450 Leersia perrieri 82.61 2.00e-53 198.00
IUUC-Loc-052290 Lepisosteus oculatus 59.48 2.00e-39 152.00
IUUC-Laf-054203 Loxodonta africana 59.48 2.00e-39 151.00
IUUC-Mcc-055307 Macaca mulatta 59.48 2.00e-39 151.00
IUUC-Meu-056515 Macropus eugenii 58.62 6.00e-39 150.00
IUUC-Mor-057276 Magnaporthe oryzae 94.92 1.00e-62 229.00
IUUC-Mpo-057469 Magnaporthe poae 94.87 9.00e-62 226.00
IUUC-Mtr-057664 Medicago truncatula 79.13 2.00e-46 175.00
IUUC-Mla-059098 Melampsora laricipopulina 91.38 9.00e-61 223.00
IUUC-Mga-060108 Meleagris gallopavo 54.70 1.00e-37 145.00
IUUC-Mvi-060496 Microbotryum violaceum 91.30 6.00e-59 216.00
IUUC-Mmr-061776 Microcebus murinus 59.48 2.00e-39 151.00
IUUC-Mdo-061915 Monodelphis domestica 58.62 6.00e-39 150.00
IUUC-Mmu-064157 Mus musculus 59.48 2.00e-39 151.00
IUUC-Mac-064739 Musa acuminata 80.00 4.00e-45 171.00
IUUC-Mpu-066028 Mustela putorius furo 59.48 4.00e-39 151.00
IUUC-Mlu-067166 Myotis lucifugus 59.48 2.00e-39 151.00
IUUC-Nfi-068367 Neosartorya fischeri 99.15 8.00e-65 236.00
IUUC-Nle-069220 Nomascus leucogenys 59.48 2.00e-39 151.00
IUUC-Opr-070777 Ochotona princeps 59.48 2.00e-39 151.00
IUUC-Ont-072343 Oreochromis niloticus 58.62 6.00e-39 150.00
IUUC-Oan-073485 Ornithorhynchus anatinus 60.95 7.00e-36 140.00
IUUC-Ocu-074148 Oryctolagus cuniculus 59.48 2.00e-39 151.00
IUUC-Oba-075926 Oryza barthii 81.20 1.00e-52 195.00
IUUC-Obr-076830 Oryza brachyantha 82.61 2.00e-53 198.00
IUUC-Ogl-077457 Oryza glaberrima 81.20 1.00e-52 195.00
IUUC-Ogu-078078 Oryza glumaepatula 81.20 1.00e-52 195.00
IUUC-Oin-079771 Oryza indica 81.20 1.00e-52 195.00
IUUC-Olo-080412 Oryza longistaminata 81.20 1.00e-52 195.00
IUUC-Ome-081791 Oryza meridionalis 81.20 1.00e-52 195.00
IUUC-Oni-082774 Oryza nivara 81.20 1.00e-52 195.00
IUUC-Opu-083501 Oryza punctata 81.74 4.00e-53 197.00
IUUC-Oru-084425 Oryza rufipogon 80.87 4.00e-52 194.00
IUUC-Osa-085439 Oryza sativa 81.20 1.00e-52 195.00
IUUC-Ola-086310 Oryzias latipes 57.76 2.00e-38 148.00
IUUC-Olu-087892 Ostreococcus lucimarinus 81.25 1.00e-52 196.00
IUUC-Oga-088312 Otolemur garnettii 59.48 2.00e-39 151.00
IUUC-Oar-089989 Ovis aries 59.48 2.00e-39 151.00
IUUC-Ptr-091108 Pan troglodytes 59.48 2.00e-39 151.00
IUUC-Pan-092269 Papio anubis 58.62 6.00e-39 150.00
IUUC-Psi-093055 Pelodiscus sinensis 55.17 2.00e-37 145.00
IUUC-Pma-094337 Petromyzon marinus 57.76 2.00e-40 155.00
IUUC-Pno-095035 Phaeosphaeria nodorum 98.29 2.00e-64 235.00
IUUC-Ppa-095701 Physcomitrella patens 83.62 1.00e-47 179.00
IUUC-Pfo-096380 Poecilia formosa 57.76 9.00e-39 149.00
IUUC-Pab-097660 Pongo abelii 59.48 2.00e-39 151.00
IUUC-Pop-100069 Populus trichocarpa 80.51 4.00e-45 171.00
IUUC-Pca-100230 Procavia capensis 59.48 2.00e-39 151.00
IUUC-Ppe-101457 Prunus persica 76.92 6.00e-46 173.00
IUUC-Pva-103103 Pteropus vampyrus 55.17 2.00e-37 145.00
IUUC-Pte-104230 Pyrenophora teres 98.29 2.00e-64 235.00
IUUC-Rno-105497 Rattus norvegicus 59.48 2.00e-39 151.00
IUUC-Sce-106150 Saccharomyces cerevisiae 79.31 1.00e-52 196.00
IUUC-Sha-106656 Sarcophilus harrisii 59.48 2.00e-39 151.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 88.79 4.00e-58 214.00
IUUC-Spo-108156 Schizosaccharomyces pombe 86.21 5.00e-49 184.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 97.44 3.00e-64 234.00
IUUC-Smo-109082 Selaginella moellendorffii 80.87 4.00e-52 194.00
IUUC-Sit-109732 Setaria italica 80.34 5.00e-52 193.00
IUUC-Sly-111488 Solanum lycopersicum 80.34 7.00e-47 176.00
IUUC-Stu-112612 Solanum tuberosum 80.51 3.00e-53 198.00
IUUC-Sar-113670 Sorex araneus 54.31 6.00e-35 137.00
IUUC-Sbi-114346 Sorghum bicolor 81.20 2.00e-52 195.00
IUUC-Sre-114964 Sporisorium reilianum 87.07 1.00e-57 212.00
IUUC-Ssc-116182 Sus scrofa 59.48 2.00e-39 151.00
IUUC-Tgu-117195 Taeniopygia guttata 58.62 6.00e-39 150.00
IUUC-Tru-118632 Takifugu rubripes 59.48 1.00e-39 153.00
IUUC-Tsy-118919 Tarsius syrichta 55.17 2.00e-37 145.00
IUUC-Tni-120706 Tetraodon nigroviridis 57.76 2.00e-38 149.00
IUUC-Tca-121335 Theobroma cacao 79.13 4.00e-46 175.00
IUUC-Tre-122077 Trichoderma reesei 100.00 1.00e-64 236.00
IUUC-Tvi-122400 Trichoderma virens 100.00 1.00e-64 236.00
IUUC-Tae-123593 Triticum aestivum 81.74 4.00e-52 194.00
IUUC-Tur-126158 Triticum urartu 76.52 5.00e-51 190.00
IUUC-Tme-126955 Tuber melanosporum 98.28 5.00e-63 231.00
IUUC-Tbe-127765 Tupaia belangeri 62.79 5.00e-30 119.00
IUUC-Ttr-128205 Tursiops truncatus 58.62 6.00e-39 150.00
IUUC-Uma-129435 Ustilago maydis 85.59 1.00e-57 212.00
IUUC-Vda-129807 Verticillium dahliae 99.17 1.00e-66 242.00
IUUC-Vpa-130804 Vicugna pacos 57.76 1.00e-38 149.00
IUUC-Vvi-130830 Vitis vinifera 82.05 6.00e-47 177.00
IUUC-Xtr-132685 Xenopus tropicalis 58.62 4.00e-39 151.00
IUUC-Xma-133400 Xiphophorus maculatus 59.48 1.00e-39 152.00
IUUC-Yli-134327 Yarrowia lipolytica 90.76 2.00e-53 199.00
IUUC-Zma-135270 Zea mays 82.61 8.00e-53 196.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved