• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • CPLM
    • BioGRID
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Ath-007639
UUCD1 version UUC-ArT-01598
Ensembl Protein ID AT1G78870.2
UniProt Accession Q94A97; Q2V4C1; Q9ZVA6; UBC35_ARATH
Genbank Protein ID AAY44874.1; AAC83026.1; AEE36164.1; AEE36165.1; AEE36166.1; AAK83603.1; AAN18113.1; AAM63067.1
Protein Name Ubiquitin-conjugating enzyme E2 35; E2 ubiquitin-conjugating enzyme 35; Ubiquitin carrier protein 35
Genbank Nucleotide ID DQ027048; AC005679; CP002684; CP002684; CP002684; AY049261; BT000544; AY085854
Gene Name UBC35; UBC13A; UBG13A; At1g78870; F9K20.8
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AT1G78870 AT1G78870.1 AT1G78870.1
AT1G78870 AT1G78870.2 AT1G78870.2
AT1G78870 AT1G78870.3 AT1G78870.3
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEO
Protein-protein Interaction
iRefIndexPINAHINTMentha
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E2/UBC E2_UBC 20435904; 16339806
Classification
Family E-value Score Start End
E2/UBC 1.80e-48 164.7 9 141
Active Site
Position(s) Description Evidence
89 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsv 98
    R+ ke+++l ++p +gisa+p+++ ++ ++v+ilGp+++pYeggvFkle+ +pe+YP+ +Pkv+fltki+hPn+++ G++Cl+ilk +kWspal++
   Q: 9 RIIKETQRLLSEPAPGISASPSED-NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILK--DKWSPALQI 103
    899*********************.9************************************************************9..********* PP
   S: 99 esvllsiqsllaepnpesplneeaaellkknreeykkk 136
    ++vllsiq+ll+ pnp++pl e++a+++k+n++e +
   Q: 104 RTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVDT 141
    *******************************9876555 PP
   

Organism Arabidopsis thaliana
Functional Description
(View)

Functional Description



     Catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Required for postreplication repair of UV-damaged DNA and for adapting root developmental programs to suboptimal availability of iron.
Catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Required for postreplication repair of UV-damaged DNA and for adapting root developmental programs to suboptimal availability of iron.
Protein Sequence
(Fasta)
MANSNLPRRI IKETQRLLSE PAPGISASPS EDNMRYFNVM ILGPTQSPYE GGVFKLELFL 60
PEEYPMAAPK VRFLTKIYHP NIDKLGRICL DILKDKWSPA LQIRTVLLSI QALLSAPNPD 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ath-007639|E2,E2/UBC|Arabidopsis thaliana
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TAGCAATAAA CAAAGGTTGC GGGAAAATAC GTAAAATAAA AGCTAATATA TTATTTGATT 60
CGTCCAGAGT TGAATTTTAA AGATAGAGAA AGGAAATCGA ATTAAAATCT TCGTCAGATT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ath-007639|E2,E2/UBC|Arabidopsis thaliana
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0025--Alternative splicing
KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005634--C:nucleus
GO:0005524--F:ATP binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0004842--F:ubiquitin-protein transferase activity
GO:0006301--P:postreplication repair
GO:0070534--P:protein K63-linked ubiquitination
GO:0046686--P:response to cadmium ion
GO:0010039--P:response to iron ion
GO:0010053--P:root epidermal cell differentiation
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG ath:AT1G78870
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000100 Aegilops tauschii 92.81 6.00e-83 298.00
IUUC-Aml-001889 Ailuropoda melanoleuca 78.01 3.00e-66 243.00
IUUC-Atr-002818 Amborella trichopoda 96.71 1.00e-85 306.00
IUUC-Apl-003469 Anas platyrhynchos 78.17 1.00e-67 247.00
IUUC-Aca-005051 Anolis carolinensis 79.59 4.00e-70 255.00
IUUC-Aly-006258 Arabidopsis lyrata 99.35 2.00e-87 313.00
IUUC-Ago-007837 Ashbya gossypii 72.97 1.00e-54 204.00
IUUC-Acl-008263 Aspergillus clavatus 72.41 7.00e-65 238.00
IUUC-Afl-008733 Aspergillus flavus 71.72 2.00e-64 236.00
IUUC-Afu-008946 Aspergillus fumigatus 72.41 7.00e-65 238.00
IUUC-Ani-009482 Aspergillus nidulans 71.43 5.00e-64 235.00
IUUC-Ang-009678 Aspergillus niger 73.10 8.00e-65 238.00
IUUC-Aor-010025 Aspergillus oryzae 71.72 2.00e-64 236.00
IUUC-Ate-010254 Aspergillus terreus 71.23 2.00e-64 237.00
IUUC-Ame-010742 Astyanax mexicanus 79.05 5.00e-70 255.00
IUUC-Bgr-012156 Blumeria graminis 68.92 2.00e-57 213.00
IUUC-Bta-012636 Bos taurus 79.59 4.00e-70 255.00
IUUC-Bci-013761 Botrytis cinerea 73.10 5.00e-64 235.00
IUUC-Bdi-014796 Brachypodium distachyon 96.73 3.00e-86 309.00
IUUC-Bol-016613 Brassica oleracea 98.69 5.00e-87 311.00
IUUC-Bra-016938 Brassica rapa 98.69 5.00e-87 311.00
IUUC-Cel-018119 Caenorhabditis elegans 79.19 2.00e-69 253.00
IUUC-Cja-019108 Callithrix jacchus 79.59 4.00e-70 255.00
IUUC-Cfa-021195 Canis familiaris 79.59 2.00e-69 253.00
IUUC-Cpo-022280 Cavia porcellus 76.19 6.00e-67 245.00
IUUC-Cre-022978 Chlamydomonas reinhardtii 85.91 5.00e-76 275.00
IUUC-Csa-023860 Chlorocebus sabaeus 72.79 4.00e-63 232.00
IUUC-Cho-024459 Choloepus hoffmanni 79.59 4.00e-70 255.00
IUUC-Cin-025278 Ciona intestinalis 79.45 3.00e-69 253.00
IUUC-Csv-025952 Ciona savignyi 70.95 2.00e-58 216.00
IUUC-Cgl-026752 Colletotrichum gloeosporioides 73.79 7.00e-65 238.00
IUUC-Cme-027100 Cyanidioschyzon merolae 64.86 3.00e-56 209.00
IUUC-Dre-027931 Danio rerio 79.73 2.00e-70 256.00
IUUC-Dno-030059 Dasypus novemcinctus 78.23 1.00e-68 251.00
IUUC-Dor-030269 Dipodomys ordii 79.84 3.00e-61 226.00
IUUC-Dse-031505 Dothistroma septosporum 69.18 1.00e-61 228.00
IUUC-Dme-032097 Drosophila melanogaster 76.19 3.00e-67 246.00
IUUC-Ete-032369 Echinops telfairi 79.59 4.00e-70 255.00
IUUC-Eca-033230 Equus caballus 79.59 4.00e-70 255.00
IUUC-Fca-036161 Felis catus 77.55 1.00e-67 247.00
IUUC-Fal-036781 Ficedula albicollis 76.87 9.00e-68 248.00
IUUC-Fox-037840 Fusarium oxysporum 73.79 2.00e-64 237.00
IUUC-Fso-038118 Fusarium solani 73.29 1.00e-64 237.00
IUUC-Gmo-039561 Gadus morhua 78.23 5.00e-69 252.00
IUUC-Ggr-039807 Gaeumannomyces graminis 73.79 3.00e-65 239.00
IUUC-Gga-041024 Gallus gallus 79.59 4.00e-70 255.00
IUUC-Gac-042450 Gasterosteus aculeatus 78.38 2.00e-68 250.00
IUUC-Gma-043982 Glycine max 99.35 2.00e-87 313.00
IUUC-Ggo-044660 Gorilla gorilla 78.91 2.00e-69 253.00
IUUC-Hsa-045881 Homo sapiens 79.59 4.00e-70 255.00
IUUC-Hvu-047346 Hordeum vulgare 98.04 2.00e-86 310.00
IUUC-Itr-048096 Ictidomys tridecemlineatus 72.79 4.00e-62 229.00
IUUC-Kpa-049285 Komagataella pastoris 72.97 1.00e-65 241.00
IUUC-Lch-050548 Latimeria chalumnae 79.14 3.00e-66 243.00
IUUC-Lpe-051394 Leersia perrieri 96.73 1.00e-85 307.00
IUUC-Loc-052205 Lepisosteus oculatus 79.05 4.00e-70 256.00
IUUC-Lma-053056 Leptosphaeria maculans 72.60 1.00e-64 237.00
IUUC-Laf-053540 Loxodonta africana 79.71 6.00e-66 241.00
IUUC-Mcc-054863 Macaca mulatta 79.59 4.00e-70 255.00
IUUC-Meu-056482 Macropus eugenii 79.71 6.00e-66 241.00
IUUC-Mor-057014 Magnaporthe oryzae 71.23 9.00e-64 234.00
IUUC-Mpo-057586 Magnaporthe poae 73.79 4.00e-65 239.00
IUUC-Mtr-058552 Medicago truncatula 89.82 2.00e-83 300.00
IUUC-Mla-058920 Melampsora laricipopulina 69.80 6.00e-63 231.00
IUUC-Mga-059649 Meleagris gallopavo 76.71 7.00e-67 244.00
IUUC-Mvi-060483 Microbotryum violaceum 74.34 1.00e-67 248.00
IUUC-Mmr-061167 Microcebus murinus 79.59 4.00e-70 255.00
IUUC-Mdo-062701 Monodelphis domestica 79.59 4.00e-70 255.00
IUUC-Mmu-064070 Mus musculus 79.59 4.00e-70 255.00
IUUC-Mac-064742 Musa acuminata 97.39 2.00e-86 309.00
IUUC-Mpu-066401 Mustela putorius furo 79.59 4.00e-70 255.00
IUUC-Mlu-067229 Myotis lucifugus 79.02 3.00e-67 246.00
IUUC-Nfi-068526 Neosartorya fischeri 72.41 8.00e-65 238.00
IUUC-Ncr-068643 Neurospora crassa 74.48 6.00e-65 238.00
IUUC-Nle-070146 Nomascus leucogenys 79.59 4.00e-70 255.00
IUUC-Ont-072369 Oreochromis niloticus 79.05 1.00e-69 254.00
IUUC-Oan-073174 Ornithorhynchus anatinus 78.47 2.00e-67 246.00
IUUC-Ocu-074712 Oryctolagus cuniculus 79.59 4.00e-70 255.00
IUUC-Oba-075408 Oryza barthii 96.73 1.00e-85 307.00
IUUC-Obr-076881 Oryza brachyantha 96.73 1.00e-85 307.00
IUUC-Ogl-077242 Oryza glaberrima 96.73 1.00e-85 307.00
IUUC-Ogu-078465 Oryza glumaepatula 96.73 1.00e-85 307.00
IUUC-Oin-080035 Oryza indica 96.45 1.00e-78 283.00
IUUC-Olo-080555 Oryza longistaminata 96.73 1.00e-85 307.00
IUUC-Ome-081653 Oryza meridionalis 96.73 1.00e-85 307.00
IUUC-Oni-082400 Oryza nivara 96.73 1.00e-85 307.00
IUUC-Opu-083130 Oryza punctata 95.77 7.00e-78 282.00
IUUC-Oru-084649 Oryza rufipogon 96.73 1.00e-85 307.00
IUUC-Osa-085629 Oryza sativa 96.73 1.00e-85 307.00
IUUC-Ola-087083 Oryzias latipes 81.08 9.00e-71 258.00
IUUC-Olu-087886 Ostreococcus lucimarinus 68.71 2.00e-59 220.00
IUUC-Oga-088983 Otolemur garnettii 75.51 1.00e-66 244.00
IUUC-Oar-090440 Ovis aries 78.91 2.00e-69 253.00
IUUC-Ptr-090572 Pan troglodytes 79.59 4.00e-70 255.00
IUUC-Pan-092503 Papio anubis 77.55 2.00e-68 249.00
IUUC-Psi-093419 Pelodiscus sinensis 78.79 2.00e-62 230.00
IUUC-Pno-094838 Phaeosphaeria nodorum 71.81 1.00e-64 238.00
IUUC-Ppa-096014 Physcomitrella patens 94.08 6.00e-84 301.00
IUUC-Pfo-096074 Poecilia formosa 81.08 9.00e-71 258.00
IUUC-Pab-097778 Pongo abelii 79.59 4.00e-70 255.00
IUUC-Pop-099707 Populus trichocarpa 98.04 1.00e-86 310.00
IUUC-Pca-100334 Procavia capensis 66.67 7.00e-58 215.00
IUUC-Ppe-101149 Prunus persica 98.69 5.00e-87 311.00
IUUC-Pva-102979 Pteropus vampyrus 79.59 4.00e-70 255.00
IUUC-Pgr-103654 Puccinia graminis 72.11 9.00e-63 231.00
IUUC-Ptt-103752 Puccinia triticina 70.14 7.00e-60 221.00
IUUC-Pte-104137 Pyrenophora teres 73.29 2.00e-64 237.00
IUUC-Pyt-104513 Pyrenophora triticirepentis 73.29 2.00e-64 237.00
IUUC-Rno-105927 Rattus norvegicus 80.27 2.00e-70 256.00
IUUC-Sce-106178 Saccharomyces cerevisiae 68.71 9.00e-61 224.00
IUUC-Sha-107493 Sarcophilus harrisii 79.59 4.00e-70 255.00
IUUC-Sja-107878 Schizosaccharomyces japonicus 67.57 2.00e-58 217.00
IUUC-Spo-108062 Schizosaccharomyces pombe 68.28 7.00e-58 214.00
IUUC-Ssl-108395 Sclerotinia sclerotiorum 74.48 4.00e-64 236.00
IUUC-Smo-109587 Selaginella moellendorffii 84.77 9.00e-75 271.00
IUUC-Sit-110151 Setaria italica 97.39 1.00e-85 308.00
IUUC-Sly-110863 Solanum lycopersicum 98.69 5.00e-87 311.00
IUUC-Stu-112722 Solanum tuberosum 98.04 2.00e-86 310.00
IUUC-Sar-113464 Sorex araneus 79.71 6.00e-66 241.00
IUUC-Sbi-114278 Sorghum bicolor 96.08 4.00e-85 305.00
IUUC-Sre-114927 Sporisorium reilianum 76.71 2.00e-68 249.00
IUUC-Ssc-116096 Sus scrofa 79.59 4.00e-70 255.00
IUUC-Tgu-117266 Taeniopygia guttata 79.71 6.00e-66 241.00
IUUC-Tru-117903 Takifugu rubripes 77.70 2.00e-69 253.00
IUUC-Tsy-118952 Tarsius syrichta 79.71 6.00e-66 241.00
IUUC-Tni-120038 Tetraodon nigroviridis 77.70 2.00e-69 253.00
IUUC-Tca-121752 Theobroma cacao 96.53 1.00e-79 288.00
IUUC-Tre-121979 Trichoderma reesei 73.10 3.00e-64 236.00
IUUC-Tvi-122515 Trichoderma virens 71.43 1.00e-63 234.00
IUUC-Tae-125309 Triticum aestivum 98.04 2.00e-86 310.00
IUUC-Tur-126687 Triticum urartu 93.75 5.00e-78 281.00
IUUC-Tme-127129 Tuber melanosporum 73.10 1.00e-64 237.00
IUUC-Tbe-127846 Tupaia belangeri 79.71 6.00e-66 241.00
IUUC-Ttr-128808 Tursiops truncatus 78.77 1.00e-67 248.00
IUUC-Uma-129548 Ustilago maydis 76.03 4.00e-68 249.00
IUUC-Vda-129810 Verticillium dahliae 71.62 6.00e-65 238.00
IUUC-Vpa-130221 Vicugna pacos 71.01 2.00e-55 206.00
IUUC-Vvi-131416 Vitis vinifera 82.07 3.00e-82 296.00
IUUC-Xtr-132366 Xenopus tropicalis 77.85 3.00e-68 249.00
IUUC-Xma-132986 Xiphophorus maculatus 80.41 3.00e-70 256.00
IUUC-Yli-134605 Yarrowia lipolytica 71.43 2.00e-63 233.00
IUUC-Zma-135587 Zea mays 93.08 2.00e-83 300.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved