• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • DNA & RNA Element
    • TRANSFAC
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Bgr-012039
Ensembl Protein ID CCU80550
UniProt Accession N1JKM0; N1JKM0_BLUG1
Genbank Protein ID CCU80550.1
Protein Name Ubiquitin-conjugating enzyme E2-17
Genbank Nucleotide ID CAUH01004741
Gene Name BGHDH14_bgh05004
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
BGHDH14_bgh05004 CCU80550 CCU80550
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.30e-49 166.0 1 128
Active Site
Position(s) Description Evidence
73 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 9    lekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesvllsiqsll 109
    +++dpp+g+sa+pv + +++ w+++i+Gp+dtp+e+g+F+l ++f+e+YP kPP vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ vl+siqsll
   Q: 1 MQTDPPAGVSASPVAD-NVMIWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPAVKFISQMFHPNVYASGELCLDILQ--NRWSPTYDVAAVLTSIQSLL 98
    689*************.9************************************************************9..******************** PP
   S: 110 aepnpesplneeaaellkknreeykkkvre 139
    ++pn++sp+n+ea++l+k+nr+ey k+vre
   Q: 99 NDPNTSSPANVEASNLYKDNRREYTKRVRE 128
    ***************************985 PP
   

Organism Blumeria graminis
Protein Sequence
(Fasta)
MQTDPPAGVS ASPVADNVMI WNAVIIGPAD TPFEDGTFRL VMQFEEQYPN KPPAVKFISQ 60
MFHPNVYASG ELCLDILQNR WSPTYDVAAV LTSIQSLLND PNTSSPANVE ASNLYKDNRR 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bgr-012039|E2,E2/UBC|Blumeria graminis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CCCGAACAGC AGTAAAACAG GGTCTGGACA TCGAGGTGTC TTGTAATAGA TTCTATTACG 60
ATTTCATTAA CAACTGAACC AATTTACATG CACTGGGACT TAGCAAATTT AACTCGGAAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bgr-012039|E2,E2/UBC|Blumeria graminis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 64.18 4.00e-54 201.00
IUUC-Aml-002120 Ailuropoda melanoleuca 66.91 3.00e-56 208.00
IUUC-Atr-002862 Amborella trichopoda 65.67 5.00e-55 204.00
IUUC-Apl-004063 Anas platyrhynchos 61.90 1.00e-53 199.00
IUUC-Aca-004714 Anolis carolinensis 66.91 5.00e-57 210.00
IUUC-Aly-006336 Arabidopsis lyrata 64.93 1.00e-47 179.00
IUUC-Ath-007547 Arabidopsis thaliana 64.93 1.00e-47 179.00
IUUC-Ago-007745 Ashbya gossypii 74.07 2.00e-62 229.00
IUUC-Acl-008139 Aspergillus clavatus 92.65 5.00e-75 270.00
IUUC-Afl-008551 Aspergillus flavus 93.38 2.00e-75 272.00
IUUC-Afu-008980 Aspergillus fumigatus 93.38 2.00e-75 272.00
IUUC-Ang-009554 Aspergillus niger 93.38 2.00e-75 272.00
IUUC-Aor-010242 Aspergillus oryzae 93.38 2.00e-75 272.00
IUUC-Ate-010390 Aspergillus terreus 93.38 2.00e-75 272.00
IUUC-Ame-010743 Astyanax mexicanus 67.65 6.00e-57 211.00
IUUC-Bta-012840 Bos taurus 66.91 3.00e-56 208.00
IUUC-Bci-013919 Botrytis cinerea 96.32 5.00e-77 277.00
IUUC-Bdi-015010 Brachypodium distachyon 65.67 1.00e-54 203.00
IUUC-Bol-015726 Brassica oleracea 64.93 5.00e-54 203.00
IUUC-Bra-016809 Brassica rapa 64.93 2.00e-54 203.00
IUUC-Cel-018244 Caenorhabditis elegans 69.40 1.00e-57 213.00
IUUC-Cja-018783 Callithrix jacchus 66.91 6.00e-57 211.00
IUUC-Cfa-020646 Canis familiaris 66.91 8.00e-57 211.00
IUUC-Cpo-021323 Cavia porcellus 67.65 4.00e-57 211.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 65.79 4.00e-44 168.00
IUUC-Csa-023588 Chlorocebus sabaeus 66.91 6.00e-57 211.00
IUUC-Cho-025061 Choloepus hoffmanni 66.06 3.00e-42 160.00
IUUC-Cin-025537 Ciona intestinalis 67.16 4.00e-47 177.00
IUUC-Csv-025846 Ciona savignyi 67.16 1.00e-50 189.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 95.59 3.00e-76 275.00
IUUC-Cne-026864 Cryptococcus neoformans 67.91 5.00e-57 211.00
IUUC-Cme-027284 Cyanidioschyzon merolae 62.22 2.00e-43 167.00
IUUC-Dre-028774 Danio rerio 66.91 6.00e-57 211.00
IUUC-Dno-029661 Dasypus novemcinctus 66.91 3.00e-56 208.00
IUUC-Dor-030452 Dipodomys ordii 66.91 3.00e-56 208.00
IUUC-Dse-031487 Dothistroma septosporum 92.65 1.00e-75 272.00
IUUC-Dme-031863 Drosophila melanogaster 69.12 2.00e-57 212.00
IUUC-Ete-032595 Echinops telfairi 63.97 5.00e-54 201.00
IUUC-Eca-033377 Equus caballus 66.91 3.00e-56 208.00
IUUC-Eeu-035191 Erinaceus europaeus 51.45 2.00e-36 142.00
IUUC-Fca-036581 Felis catus 66.91 6.00e-57 211.00
IUUC-Fal-037474 Ficedula albicollis 68.64 3.00e-50 187.00
IUUC-Fox-037808 Fusarium oxysporum 94.85 1.00e-75 273.00
IUUC-Fso-038232 Fusarium solani 94.12 3.00e-75 271.00
IUUC-Gmo-038517 Gadus morhua 66.91 6.00e-57 211.00
IUUC-Ggr-039875 Gaeumannomyces graminis 93.33 6.00e-74 267.00
IUUC-Gga-040588 Gallus gallus 66.91 6.00e-57 211.00
IUUC-Gac-042471 Gasterosteus aculeatus 66.91 8.00e-57 210.00
IUUC-Gma-043688 Glycine max 66.42 3.00e-55 205.00
IUUC-Ggo-044896 Gorilla gorilla 66.91 6.00e-57 211.00
IUUC-Hsa-046383 Homo sapiens 66.91 6.00e-57 211.00
IUUC-Hvu-047054 Hordeum vulgare 64.18 4.00e-54 201.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 66.91 6.00e-57 211.00
IUUC-Kpa-049225 Komagataella pastoris 80.60 2.00e-65 239.00
IUUC-Lch-049964 Latimeria chalumnae 66.91 6.00e-57 211.00
IUUC-Lpe-051301 Leersia perrieri 65.67 7.00e-55 204.00
IUUC-Loc-051962 Lepisosteus oculatus 68.38 1.00e-57 213.00
IUUC-Laf-053680 Loxodonta africana 66.91 6.00e-57 211.00
IUUC-Mcc-055546 Macaca mulatta 66.91 1.00e-56 210.00
IUUC-Meu-056231 Macropus eugenii 66.91 6.00e-57 211.00
IUUC-Mor-057087 Magnaporthe oryzae 91.85 2.00e-73 265.00
IUUC-Mpo-057498 Magnaporthe poae 93.33 3.00e-74 268.00
IUUC-Mtr-058612 Medicago truncatula 65.67 1.00e-46 176.00
IUUC-Mla-058876 Melampsora laricipopulina 72.79 1.00e-55 206.00
IUUC-Mga-059863 Meleagris gallopavo 66.91 3.00e-56 208.00
IUUC-Mvi-060330 Microbotryum violaceum 74.26 1.00e-55 206.00
IUUC-Mmr-060630 Microcebus murinus 66.91 3.00e-56 208.00
IUUC-Mdo-062292 Monodelphis domestica 66.91 6.00e-57 211.00
IUUC-Mmu-063680 Mus musculus 66.91 6.00e-57 211.00
IUUC-Mac-065641 Musa acuminata 65.67 5.00e-55 204.00
IUUC-Mpu-065803 Mustela putorius furo 66.91 3.00e-56 208.00
IUUC-Mlu-067147 Myotis lucifugus 66.91 3.00e-56 208.00
IUUC-Nfi-068580 Neosartorya fischeri 93.38 2.00e-75 272.00
IUUC-Ncr-068913 Neurospora crassa 92.65 2.00e-74 268.00
IUUC-Nle-069121 Nomascus leucogenys 66.91 6.00e-57 211.00
IUUC-Opr-070935 Ochotona princeps 66.91 3.00e-56 208.00
IUUC-Ont-071335 Oreochromis niloticus 66.91 3.00e-57 211.00
IUUC-Oan-072706 Ornithorhynchus anatinus 66.91 3.00e-56 208.00
IUUC-Ocu-074550 Oryctolagus cuniculus 66.91 1.00e-56 210.00
IUUC-Oba-075896 Oryza barthii 65.67 7.00e-55 203.00
IUUC-Obr-076770 Oryza brachyantha 66.42 2.00e-55 205.00
IUUC-Ogl-077116 Oryza glaberrima 65.67 7.00e-55 204.00
IUUC-Ogu-078696 Oryza glumaepatula 65.67 7.00e-55 204.00
IUUC-Oin-079099 Oryza indica 65.67 7.00e-55 204.00
IUUC-Olo-081018 Oryza longistaminata 54.00 4.00e-45 172.00
IUUC-Ome-081285 Oryza meridionalis 65.67 7.00e-55 204.00
IUUC-Oni-082088 Oryza nivara 65.67 7.00e-55 204.00
IUUC-Opu-083310 Oryza punctata 65.67 7.00e-55 204.00
IUUC-Oru-084449 Oryza rufipogon 65.67 7.00e-55 204.00
IUUC-Osa-085923 Oryza sativa 65.67 7.00e-55 204.00
IUUC-Ola-086407 Oryzias latipes 66.91 6.00e-57 211.00
IUUC-Olu-087830 Ostreococcus lucimarinus 64.18 3.00e-46 175.00
IUUC-Oga-088659 Otolemur garnettii 66.91 6.00e-57 211.00
IUUC-Oar-090141 Ovis aries 66.91 3.00e-56 208.00
IUUC-Ptr-091305 Pan troglodytes 66.91 6.00e-57 211.00
IUUC-Pan-092740 Papio anubis 66.91 1.00e-56 210.00
IUUC-Psi-094094 Pelodiscus sinensis 66.91 6.00e-57 211.00
IUUC-Pma-094239 Petromyzon marinus 66.18 6.00e-57 210.00
IUUC-Pno-094935 Phaeosphaeria nodorum 91.18 8.00e-74 266.00
IUUC-Ppa-095689 Physcomitrella patens 67.86 5.00e-46 174.00
IUUC-Pfo-096656 Poecilia formosa 66.18 8.00e-57 210.00
IUUC-Pab-097972 Pongo abelii 66.91 6.00e-57 211.00
IUUC-Pop-099517 Populus trichocarpa 65.67 5.00e-55 204.00
IUUC-Pca-100906 Procavia capensis 61.03 3.00e-50 188.00
IUUC-Ppe-101594 Prunus persica 65.67 4.00e-55 204.00
IUUC-Pva-102380 Pteropus vampyrus 66.18 8.00e-55 203.00
IUUC-Pgr-103611 Puccinia graminis 72.79 7.00e-56 207.00
IUUC-Ptt-103971 Puccinia triticina 76.27 3.00e-49 184.00
IUUC-Pte-104378 Pyrenophora teres 91.18 2.00e-74 268.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 91.18 2.00e-74 268.00
IUUC-Rno-105772 Rattus norvegicus 66.91 2.00e-56 209.00
IUUC-Sce-106283 Saccharomyces cerevisiae 74.07 2.00e-62 229.00
IUUC-Sha-107650 Sarcophilus harrisii 66.18 6.00e-55 204.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 80.00 9.00e-59 216.00
IUUC-Spo-108073 Schizosaccharomyces pombe 80.00 8.00e-59 217.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 96.32 5.00e-77 277.00
IUUC-Smo-109036 Selaginella moellendorffii 66.42 2.00e-55 205.00
IUUC-Sit-110731 Setaria italica 65.67 7.00e-55 204.00
IUUC-Sly-111506 Solanum lycopersicum 65.67 4.00e-55 204.00
IUUC-Stu-112080 Solanum tuberosum 65.67 4.00e-55 204.00
IUUC-Sar-113429 Sorex araneus 66.91 3.00e-56 208.00
IUUC-Sbi-114289 Sorghum bicolor 65.67 7.00e-55 204.00
IUUC-Sre-115106 Sporisorium reilianum 73.53 4.00e-56 208.00
IUUC-Ssc-116265 Sus scrofa 66.91 6.00e-57 211.00
IUUC-Tgu-117383 Taeniopygia guttata 66.91 6.00e-57 211.00
IUUC-Tru-118576 Takifugu rubripes 66.18 2.00e-56 208.00
IUUC-Tsy-119000 Tarsius syrichta 66.91 3.00e-56 208.00
IUUC-Tni-119745 Tetraodon nigroviridis 66.18 1.00e-56 209.00
IUUC-Tca-121827 Theobroma cacao 66.42 3.00e-55 205.00
IUUC-Tre-122002 Trichoderma reesei 93.38 3.00e-75 271.00
IUUC-Tvi-122331 Trichoderma virens 93.38 3.00e-75 271.00
IUUC-Tae-124461 Triticum aestivum 64.93 2.00e-54 203.00
IUUC-Tur-126866 Triticum urartu 64.93 1.00e-54 202.00
IUUC-Tme-127148 Tuber melanosporum 91.85 3.00e-74 268.00
IUUC-Tbe-127921 Tupaia belangeri 64.71 9.00e-52 193.00
IUUC-Ttr-129121 Tursiops truncatus 66.91 3.00e-56 208.00
IUUC-Uma-129561 Ustilago maydis 73.53 2.00e-56 209.00
IUUC-Vda-129711 Verticillium dahliae 95.59 3.00e-76 275.00
IUUC-Vpa-130570 Vicugna pacos 61.76 2.00e-50 189.00
IUUC-Vvi-131108 Vitis vinifera 65.67 2.00e-55 205.00
IUUC-Xtr-131824 Xenopus tropicalis 66.91 6.00e-57 211.00
IUUC-Xma-133937 Xiphophorus maculatus 66.91 6.00e-57 211.00
IUUC-Yli-134660 Yarrowia lipolytica 84.56 2.00e-69 252.00
IUUC-Zma-135584 Zea mays 64.18 4.00e-54 201.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved