• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • DNA & RNA Element
    • TRANSFAC
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Sre-115106
Ensembl Protein ID CBQ70615
UniProt Accession E6ZTQ8; E6ZTQ8_SPORE
Genbank Protein ID CBQ70615.1
Protein Name Probable RAD6-E2 ubiquitin-conjugating enzyme
Genbank Nucleotide ID FQ311441
Gene Name sr10284
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
sr10284 CBQ70615 CBQ70615
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 3.20e-51 171.2 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl +++k+l++dpp gis p + +l+ w+++i+Gp+dtp+e+g+Fkl ++f+e+YP kPP+vkfl+k+fhPnvy+nG++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLIRDFKRLSTDPPGGISGAPCAD-NLMIWNAVIFGPADTPFEDGTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQ--NRWSPTYDVAAI 105
    899*********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+siqsll++pnp+sp+n+eaa+l+++n +ey ++v+
   Q: 106 LTSIQSLLHDPNPNSPANAEAASLYRENMKEYVRRVK 142
    *********************************9997 PP
   

Organism Sporisorium reilianum
Protein Sequence
(Fasta)
MSTPSKKRLI RDFKRLSTDP PGGISGAPCA DNLMIWNAVI FGPADTPFED GTFKLVLTFD 60
ESYPNKPPTV KFLSKMFHPN VYANGELCLD ILQNRWSPTY DVAAILTSIQ SLLHDPNPNS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sre-115106|E2,E2/UBC|Sporisorium reilianum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGTAAGTG CACACGGGAC GATACGAGTG AATCGCCAGG CAGCTGCAAC GACGCTGACT 60
CAAATGCTTT CCGCTACTTG TCGTATCGCT TCGGCAGTCC ACACCGTCAA AGAAGCGTCT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sre-115106|E2,E2/UBC|Sporisorium reilianum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 71.05 2.00e-65 239.00
IUUC-Aml-002120 Ailuropoda melanoleuca 74.17 4.00e-68 248.00
IUUC-Atr-002862 Amborella trichopoda 72.48 2.00e-65 239.00
IUUC-Apl-004063 Anas platyrhynchos 68.92 3.00e-58 215.00
IUUC-Aca-005001 Anolis carolinensis 73.51 5.00e-68 247.00
IUUC-Aly-005584 Arabidopsis lyrata 71.71 2.00e-65 239.00
IUUC-Ath-007149 Arabidopsis thaliana 71.71 2.00e-65 239.00
IUUC-Ago-007745 Ashbya gossypii 71.14 5.00e-66 241.00
IUUC-Acl-008139 Aspergillus clavatus 73.51 8.00e-69 250.00
IUUC-Afl-008551 Aspergillus flavus 73.51 6.00e-69 251.00
IUUC-Afu-008980 Aspergillus fumigatus 73.51 6.00e-69 251.00
IUUC-Ani-009470 Aspergillus nidulans 49.28 2.00e-28 117.00
IUUC-Ang-009554 Aspergillus niger 73.51 6.00e-69 251.00
IUUC-Aor-010242 Aspergillus oryzae 73.51 6.00e-69 251.00
IUUC-Ate-010390 Aspergillus terreus 73.51 6.00e-69 251.00
IUUC-Ame-010743 Astyanax mexicanus 73.51 4.00e-69 251.00
IUUC-Bgr-012039 Blumeria graminis 73.53 3.00e-62 228.00
IUUC-Bta-012840 Bos taurus 74.17 4.00e-68 248.00
IUUC-Bci-013919 Botrytis cinerea 73.03 7.00e-70 254.00
IUUC-Bdi-014308 Brachypodium distachyon 71.71 3.00e-65 238.00
IUUC-Bol-016245 Brassica oleracea 71.71 2.00e-65 239.00
IUUC-Bra-016809 Brassica rapa 71.71 2.00e-65 240.00
IUUC-Cel-018244 Caenorhabditis elegans 69.88 9.00e-69 250.00
IUUC-Cja-018783 Callithrix jacchus 72.85 3.00e-68 248.00
IUUC-Cfa-020646 Canis familiaris 72.85 6.00e-68 248.00
IUUC-Cpo-021323 Cavia porcellus 72.85 3.00e-68 248.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 67.07 5.00e-57 211.00
IUUC-Csa-023588 Chlorocebus sabaeus 72.85 3.00e-68 248.00
IUUC-Cho-024773 Choloepus hoffmanni 56.95 3.00e-47 178.00
IUUC-Cin-025537 Ciona intestinalis 68.46 1.00e-52 196.00
IUUC-Csv-025846 Ciona savignyi 69.13 7.00e-56 207.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 72.85 2.00e-68 248.00
IUUC-Cne-026864 Cryptococcus neoformans 76.51 2.00e-69 252.00
IUUC-Cme-027284 Cyanidioschyzon merolae 66.23 6.00e-50 188.00
IUUC-Dre-027775 Danio rerio 72.85 2.00e-68 249.00
IUUC-Dno-029661 Dasypus novemcinctus 74.17 4.00e-68 248.00
IUUC-Dor-030452 Dipodomys ordii 74.26 3.00e-60 221.00
IUUC-Dse-031487 Dothistroma septosporum 72.85 3.00e-68 248.00
IUUC-Dme-031863 Drosophila melanogaster 74.83 2.00e-68 249.00
IUUC-Ete-032595 Echinops telfairi 73.15 1.00e-66 243.00
IUUC-Eca-033377 Equus caballus 74.17 4.00e-68 248.00
IUUC-Eeu-035191 Erinaceus europaeus 56.86 2.00e-47 179.00
IUUC-Fca-036581 Felis catus 72.85 3.00e-68 248.00
IUUC-Fal-037474 Ficedula albicollis 75.42 2.00e-53 199.00
IUUC-Fox-037808 Fusarium oxysporum 72.85 2.00e-68 248.00
IUUC-Fso-038232 Fusarium solani 72.85 3.00e-68 248.00
IUUC-Gmo-038517 Gadus morhua 72.85 3.00e-68 248.00
IUUC-Ggr-039875 Gaeumannomyces graminis 72.37 5.00e-68 248.00
IUUC-Gga-040588 Gallus gallus 72.85 3.00e-68 248.00
IUUC-Gac-042471 Gasterosteus aculeatus 72.85 4.00e-68 248.00
IUUC-Gma-043865 Glycine max 71.71 5.00e-66 241.00
IUUC-Ggo-044896 Gorilla gorilla 72.85 3.00e-68 248.00
IUUC-Hsa-046383 Homo sapiens 72.85 3.00e-68 248.00
IUUC-Hvu-047054 Hordeum vulgare 71.05 2.00e-65 239.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 72.85 3.00e-68 248.00
IUUC-Kpa-049225 Komagataella pastoris 70.47 7.00e-66 241.00
IUUC-Lch-050283 Latimeria chalumnae 74.17 2.00e-68 249.00
IUUC-Lpe-051301 Leersia perrieri 71.71 2.00e-65 239.00
IUUC-Loc-051962 Lepisosteus oculatus 73.51 1.00e-68 250.00
IUUC-Laf-053680 Loxodonta africana 72.85 3.00e-68 248.00
IUUC-Mcc-054819 Macaca mulatta 74.17 2.00e-68 249.00
IUUC-Meu-056231 Macropus eugenii 72.85 3.00e-68 248.00
IUUC-Mor-057087 Magnaporthe oryzae 72.66 1.00e-61 226.00
IUUC-Mpo-057498 Magnaporthe poae 72.37 4.00e-68 249.00
IUUC-Mtr-058305 Medicago truncatula 71.71 9.00e-66 240.00
IUUC-Mla-058876 Melampsora laricipopulina 87.50 6.00e-74 267.00
IUUC-Mga-059863 Meleagris gallopavo 73.38 4.00e-61 224.00
IUUC-Mvi-060330 Microbotryum violaceum 84.52 4.00e-72 261.00
IUUC-Mmr-060630 Microcebus murinus 74.17 4.00e-68 248.00
IUUC-Mdo-062292 Monodelphis domestica 72.85 3.00e-68 248.00
IUUC-Mmu-063680 Mus musculus 72.85 3.00e-68 248.00
IUUC-Mac-065428 Musa acuminata 70.39 7.00e-65 238.00
IUUC-Mpu-065803 Mustela putorius furo 74.17 4.00e-68 248.00
IUUC-Mlu-067147 Myotis lucifugus 74.17 4.00e-68 248.00
IUUC-Nfi-068580 Neosartorya fischeri 73.51 6.00e-69 251.00
IUUC-Ncr-068913 Neurospora crassa 72.85 6.00e-68 247.00
IUUC-Nle-069121 Nomascus leucogenys 72.85 3.00e-68 248.00
IUUC-Opr-070935 Ochotona princeps 74.17 4.00e-68 248.00
IUUC-Ont-071335 Oreochromis niloticus 72.85 1.00e-68 249.00
IUUC-Oan-072706 Ornithorhynchus anatinus 69.59 2.00e-61 226.00
IUUC-Ocu-074550 Oryctolagus cuniculus 72.85 6.00e-68 248.00
IUUC-Oba-075847 Oryza barthii 71.71 7.00e-65 238.00
IUUC-Obr-076713 Oryza brachyantha 71.71 2.00e-65 239.00
IUUC-Ogl-076956 Oryza glaberrima 71.71 3.00e-65 238.00
IUUC-Ogu-078696 Oryza glumaepatula 71.71 2.00e-65 239.00
IUUC-Oin-080106 Oryza indica 71.71 3.00e-65 238.00
IUUC-Olo-081018 Oryza longistaminata 62.42 5.00e-56 208.00
IUUC-Ome-081285 Oryza meridionalis 71.71 2.00e-65 239.00
IUUC-Oni-082088 Oryza nivara 71.71 2.00e-65 239.00
IUUC-Opu-083848 Oryza punctata 71.71 9.00e-65 237.00
IUUC-Oru-084449 Oryza rufipogon 71.71 2.00e-65 239.00
IUUC-Osa-086191 Oryza sativa 71.71 3.00e-65 238.00
IUUC-Ola-087160 Oryzias latipes 72.85 1.00e-68 249.00
IUUC-Olu-087830 Ostreococcus lucimarinus 70.47 3.00e-54 202.00
IUUC-Oga-088659 Otolemur garnettii 72.85 3.00e-68 248.00
IUUC-Oar-090141 Ovis aries 74.17 4.00e-68 248.00
IUUC-Ptr-091305 Pan troglodytes 72.85 3.00e-68 248.00
IUUC-Pan-092511 Papio anubis 74.17 4.00e-68 248.00
IUUC-Psi-094094 Pelodiscus sinensis 72.85 3.00e-68 248.00
IUUC-Pma-094376 Petromyzon marinus 73.51 8.00e-68 247.00
IUUC-Pno-094935 Phaeosphaeria nodorum 73.51 6.00e-69 250.00
IUUC-Ppa-095689 Physcomitrella patens 77.95 5.00e-58 214.00
IUUC-Pfo-096784 Poecilia formosa 72.85 2.00e-68 249.00
IUUC-Pab-097972 Pongo abelii 72.85 3.00e-68 248.00
IUUC-Pop-099517 Populus trichocarpa 71.71 1.00e-65 239.00
IUUC-Pca-100906 Procavia capensis 67.55 1.00e-61 226.00
IUUC-Ppe-101594 Prunus persica 71.71 1.00e-65 239.00
IUUC-Pva-102380 Pteropus vampyrus 72.19 3.00e-66 241.00
IUUC-Pgr-103611 Puccinia graminis 87.18 3.00e-76 275.00
IUUC-Ptt-103971 Puccinia triticina 88.62 1.00e-58 216.00
IUUC-Pte-104378 Pyrenophora teres 74.17 2.00e-69 252.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 74.17 2.00e-69 252.00
IUUC-Rno-105772 Rattus norvegicus 74.17 2.00e-68 249.00
IUUC-Sce-106283 Saccharomyces cerevisiae 71.14 5.00e-66 241.00
IUUC-Sha-107650 Sarcophilus harrisii 73.51 1.00e-66 243.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 78.52 9.00e-64 233.00
IUUC-Spo-108073 Schizosaccharomyces pombe 79.19 6.00e-64 234.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 73.03 7.00e-70 254.00
IUUC-Smo-109036 Selaginella moellendorffii 74.50 3.00e-66 241.00
IUUC-Sit-110731 Setaria italica 71.71 2.00e-65 239.00
IUUC-Sly-111506 Solanum lycopersicum 71.71 1.00e-65 240.00
IUUC-Stu-112618 Solanum tuberosum 71.71 1.00e-65 240.00
IUUC-Sar-113429 Sorex araneus 74.17 4.00e-68 248.00
IUUC-Sbi-114788 Sorghum bicolor 71.05 2.00e-65 239.00
IUUC-Ssc-116265 Sus scrofa 72.85 3.00e-68 248.00
IUUC-Tgu-117383 Taeniopygia guttata 72.85 3.00e-68 248.00
IUUC-Tru-118576 Takifugu rubripes 72.19 3.00e-68 248.00
IUUC-Tsy-119000 Tarsius syrichta 74.17 4.00e-68 248.00
IUUC-Tni-119745 Tetraodon nigroviridis 72.19 6.00e-68 247.00
IUUC-Tca-121827 Theobroma cacao 71.71 1.00e-65 240.00
IUUC-Tre-122002 Trichoderma reesei 72.85 3.00e-68 248.00
IUUC-Tvi-122331 Trichoderma virens 72.85 3.00e-68 248.00
IUUC-Tae-124461 Triticum aestivum 71.05 2.00e-65 239.00
IUUC-Tur-126866 Triticum urartu 71.71 2.00e-65 239.00
IUUC-Tme-127148 Tuber melanosporum 73.15 2.00e-68 249.00
IUUC-Tbe-127921 Tupaia belangeri 72.19 7.00e-64 233.00
IUUC-Ttr-129121 Tursiops truncatus 74.17 4.00e-68 248.00
IUUC-Uma-129561 Ustilago maydis 98.11 1.00e-83 300.00
IUUC-Vda-129711 Verticillium dahliae 72.85 2.00e-68 248.00
IUUC-Vpa-130570 Vicugna pacos 69.12 1.00e-54 203.00
IUUC-Vvi-131547 Vitis vinifera 71.71 1.00e-65 240.00
IUUC-Xtr-131824 Xenopus tropicalis 73.51 2.00e-68 249.00
IUUC-Xma-133667 Xiphophorus maculatus 72.85 1.00e-68 249.00
IUUC-Yli-134660 Yarrowia lipolytica 70.20 1.00e-66 243.00
IUUC-Zma-135584 Zea mays 71.05 4.00e-65 238.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved