• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • DNA & RNA Element
    • TRANSFAC
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Tme-127148
Ensembl Protein ID CAZ83085
UniProt Accession D5GEZ2; D5GEZ2_TUBMM
Genbank Protein ID CAZ83085.1
Protein Name Uncharacterized protein
Genbank Nucleotide ID FN430197
Gene Name GSTUM_00006668001
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
GSTUM_00006668001 CAZ83085 CAZ83085
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 2.80e-52 174.8 8 143
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsvesv 101
    Rl++++k++++dpp+g+sa+p ++ ++++w+++i+Gp dtp+e+g+F+l ++f+e+YP kPP+vkf++++fhPnvy++G++Cl+il+ ++Wsp+++v+ +
   Q: 8 RLMRDFKRMQTDPPAGVSASPISD-NVMTWNAVIIGPVDTPFEDGTFRLVMHFEEQYPNKPPSVKFISQMFHPNVYATGELCLDILQ--NRWSPTYDVAAI 105
    9***********************.9************************************************************9..************ PP
   S: 102 llsiqsllaepnpesplneeaaellkknreeykkkvre 139
    l+siqsll++pn++sp+n+ea++l+k+n++ey k+vre
   Q: 106 LTSIQSLLNDPNTSSPANVEASNLYKDNKREYVKRVRE 143
    ***********************************985 PP
   

Organism Tuber melanosporum
Protein Sequence
(Fasta)
MSTSARRRLM RDFKRMQTDP PAGVSASPIS DNVMTWNAVI IGPVDTPFED GTFRLVMHFE 60
EQYPNKPPSV KFISQMFHPN VYATGELCLD ILQNRWSPTY DVAAILTSIQ SLLNDPNTSS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Tme-127148|E2,E2/UBC|Tuber melanosporum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CAGAGCTCCC ACTCCATTAC TGCTACAACT CACAGCCTTC CCCTCAACTG TCCCCGCTAC 60
CTAATTCTCA AGGAACATCT TCCTATTAGC ATATTCAACA TTTCGCTCTC GCAATGTCTA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Tme-127148|E2,E2/UBC|Tuber melanosporum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

KEGG tml:GSTUM_00006668001
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 66.44 2.00e-61 225.00
IUUC-Aml-002120 Ailuropoda melanoleuca 71.14 7.00e-65 237.00
IUUC-Atr-002862 Amborella trichopoda 67.55 1.00e-62 229.00
IUUC-Apl-004063 Anas platyrhynchos 63.70 2.00e-54 202.00
IUUC-Aca-005001 Anolis carolinensis 70.47 9.00e-65 236.00
IUUC-Aly-006336 Arabidopsis lyrata 67.79 1.00e-55 206.00
IUUC-Ath-007547 Arabidopsis thaliana 67.79 1.00e-55 206.00
IUUC-Ago-007745 Ashbya gossypii 78.00 2.00e-71 259.00
IUUC-Acl-008139 Aspergillus clavatus 94.00 9.00e-85 303.00
IUUC-Afl-008551 Aspergillus flavus 94.67 3.00e-85 305.00
IUUC-Afu-008980 Aspergillus fumigatus 94.67 3.00e-85 305.00
IUUC-Ang-009554 Aspergillus niger 94.67 3.00e-85 305.00
IUUC-Aor-010242 Aspergillus oryzae 94.67 3.00e-85 305.00
IUUC-Ate-010390 Aspergillus terreus 94.67 3.00e-85 305.00
IUUC-Ame-010743 Astyanax mexicanus 72.48 8.00e-66 240.00
IUUC-Bgr-012039 Blumeria graminis 91.85 3.00e-74 268.00
IUUC-Bta-012840 Bos taurus 71.14 7.00e-65 237.00
IUUC-Bci-013919 Botrytis cinerea 92.67 3.00e-83 298.00
IUUC-Bdi-015010 Brachypodium distachyon 68.46 3.00e-62 228.00
IUUC-Bol-015726 Brassica oleracea 67.79 1.00e-61 228.00
IUUC-Bra-016803 Brassica rapa 67.79 1.00e-55 206.00
IUUC-Cel-018244 Caenorhabditis elegans 70.47 1.00e-65 239.00
IUUC-Cja-018783 Callithrix jacchus 70.39 6.00e-66 240.00
IUUC-Cfa-020244 Canis familiaris 71.14 7.00e-65 237.00
IUUC-Cpo-021323 Cavia porcellus 71.05 4.00e-66 241.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 68.22 4.00e-52 194.00
IUUC-Csa-023588 Chlorocebus sabaeus 70.39 6.00e-66 240.00
IUUC-Cho-024773 Choloepus hoffmanni 56.38 5.00e-45 171.00
IUUC-Cin-025537 Ciona intestinalis 69.80 2.00e-54 202.00
IUUC-Csv-025846 Ciona savignyi 69.80 9.00e-58 213.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 92.67 2.00e-83 298.00
IUUC-Cne-026864 Cryptococcus neoformans 70.47 6.00e-65 237.00
IUUC-Cme-027284 Cyanidioschyzon merolae 62.67 1.00e-49 187.00
IUUC-Dre-027775 Danio rerio 71.81 5.00e-66 240.00
IUUC-Dno-029661 Dasypus novemcinctus 71.14 7.00e-65 237.00
IUUC-Dor-030452 Dipodomys ordii 68.66 2.00e-56 209.00
IUUC-Dse-031487 Dothistroma septosporum 94.67 1.00e-84 302.00
IUUC-Dme-031863 Drosophila melanogaster 71.14 2.00e-64 235.00
IUUC-Ete-032595 Echinops telfairi 69.13 2.00e-63 232.00
IUUC-Eca-033377 Equus caballus 71.14 7.00e-65 237.00
IUUC-Eeu-035191 Erinaceus europaeus 56.49 2.00e-45 172.00
IUUC-Fca-036581 Felis catus 70.39 6.00e-66 240.00
IUUC-Fal-037474 Ficedula albicollis 69.75 1.00e-50 189.00
IUUC-Fox-037808 Fusarium oxysporum 92.67 3.00e-83 298.00
IUUC-Fso-038232 Fusarium solani 92.00 9.00e-83 296.00
IUUC-Gmo-038517 Gadus morhua 70.39 6.00e-66 240.00
IUUC-Ggr-039875 Gaeumannomyces graminis 94.04 4.00e-85 304.00
IUUC-Gga-040588 Gallus gallus 70.39 6.00e-66 240.00
IUUC-Gac-041504 Gasterosteus aculeatus 70.39 2.00e-65 239.00
IUUC-Gma-043865 Glycine max 68.46 6.00e-63 230.00
IUUC-Ggo-044896 Gorilla gorilla 70.39 6.00e-66 240.00
IUUC-Hsa-046383 Homo sapiens 70.39 6.00e-66 240.00
IUUC-Hvu-047054 Hordeum vulgare 66.44 2.00e-61 225.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 70.39 6.00e-66 240.00
IUUC-Kpa-049225 Komagataella pastoris 81.88 2.00e-74 269.00
IUUC-Lch-049964 Latimeria chalumnae 70.39 6.00e-66 240.00
IUUC-Lpe-051301 Leersia perrieri 68.46 2.00e-62 229.00
IUUC-Loc-051731 Lepisosteus oculatus 70.39 6.00e-66 240.00
IUUC-Laf-053680 Loxodonta africana 70.39 6.00e-66 240.00
IUUC-Mcc-055546 Macaca mulatta 70.39 2.00e-65 239.00
IUUC-Meu-056231 Macropus eugenii 70.39 6.00e-66 240.00
IUUC-Mor-057087 Magnaporthe oryzae 94.85 2.00e-76 275.00
IUUC-Mpo-057498 Magnaporthe poae 94.04 4.00e-85 305.00
IUUC-Mtr-058612 Medicago truncatula 68.46 3.00e-54 201.00
IUUC-Mla-058876 Melampsora laricipopulina 73.83 9.00e-63 230.00
IUUC-Mga-059863 Meleagris gallopavo 68.89 4.00e-57 211.00
IUUC-Mvi-060330 Microbotryum violaceum 75.17 7.00e-62 227.00
IUUC-Mmr-060630 Microcebus murinus 71.14 7.00e-65 237.00
IUUC-Mdo-062292 Monodelphis domestica 70.39 6.00e-66 240.00
IUUC-Mmu-063680 Mus musculus 70.39 6.00e-66 240.00
IUUC-Mac-064774 Musa acuminata 68.46 2.00e-62 229.00
IUUC-Mpu-065803 Mustela putorius furo 71.14 7.00e-65 237.00
IUUC-Mlu-067147 Myotis lucifugus 71.14 7.00e-65 237.00
IUUC-Nfi-068580 Neosartorya fischeri 94.67 3.00e-85 305.00
IUUC-Ncr-068913 Neurospora crassa 93.33 1.00e-83 299.00
IUUC-Nle-069121 Nomascus leucogenys 70.39 6.00e-66 240.00
IUUC-Opr-070935 Ochotona princeps 71.14 7.00e-65 237.00
IUUC-Ont-071716 Oreochromis niloticus 71.14 4.00e-65 238.00
IUUC-Oan-072706 Ornithorhynchus anatinus 65.97 6.00e-58 214.00
IUUC-Ocu-074550 Oryctolagus cuniculus 70.39 1.00e-65 240.00
IUUC-Oba-075896 Oryza barthii 68.46 4.00e-62 228.00
IUUC-Obr-076713 Oryza brachyantha 68.46 2.00e-62 229.00
IUUC-Ogl-077116 Oryza glaberrima 68.46 2.00e-62 229.00
IUUC-Ogu-078696 Oryza glumaepatula 68.46 2.00e-62 229.00
IUUC-Oin-079099 Oryza indica 68.46 2.00e-62 229.00
IUUC-Olo-081018 Oryza longistaminata 57.58 2.00e-52 196.00
IUUC-Ome-081285 Oryza meridionalis 68.46 2.00e-62 229.00
IUUC-Oni-082088 Oryza nivara 68.46 2.00e-62 229.00
IUUC-Opu-083310 Oryza punctata 68.46 2.00e-62 229.00
IUUC-Oru-084449 Oryza rufipogon 68.46 2.00e-62 229.00
IUUC-Osa-085923 Oryza sativa 68.46 2.00e-62 229.00
IUUC-Ola-086407 Oryzias latipes 70.39 6.00e-66 240.00
IUUC-Olu-087830 Ostreococcus lucimarinus 66.44 3.00e-53 198.00
IUUC-Oga-088659 Otolemur garnettii 70.39 6.00e-66 240.00
IUUC-Oar-090141 Ovis aries 71.14 7.00e-65 237.00
IUUC-Ptr-091305 Pan troglodytes 70.39 6.00e-66 240.00
IUUC-Pan-092740 Papio anubis 70.39 2.00e-65 239.00
IUUC-Psi-094094 Pelodiscus sinensis 70.39 6.00e-66 240.00
IUUC-Pma-094376 Petromyzon marinus 71.14 1.00e-64 236.00
IUUC-Pno-094935 Phaeosphaeria nodorum 92.00 9.00e-83 296.00
IUUC-Ppa-095689 Physcomitrella patens 69.29 3.00e-53 198.00
IUUC-Pfo-096656 Poecilia formosa 69.74 8.00e-66 240.00
IUUC-Pab-097972 Pongo abelii 70.39 6.00e-66 240.00
IUUC-Pop-099734 Populus trichocarpa 68.46 1.00e-56 209.00
IUUC-Pca-100906 Procavia capensis 65.13 4.00e-59 218.00
IUUC-Ppe-101594 Prunus persica 68.46 9.00e-63 230.00
IUUC-Pva-102380 Pteropus vampyrus 69.74 9.00e-64 233.00
IUUC-Pgr-103611 Puccinia graminis 73.83 4.00e-63 231.00
IUUC-Ptt-103971 Puccinia triticina 78.45 6.00e-49 184.00
IUUC-Pte-104378 Pyrenophora teres 93.33 1.00e-83 299.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 93.33 1.00e-83 299.00
IUUC-Rno-105772 Rattus norvegicus 71.14 4.00e-65 238.00
IUUC-Sce-106283 Saccharomyces cerevisiae 78.00 2.00e-71 259.00
IUUC-Sha-107650 Sarcophilus harrisii 70.47 2.00e-63 232.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 82.12 9.00e-68 246.00
IUUC-Spo-108073 Schizosaccharomyces pombe 82.78 7.00e-68 247.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 92.67 3.00e-83 298.00
IUUC-Smo-109512 Selaginella moellendorffii 67.79 5.00e-62 227.00
IUUC-Sit-110731 Setaria italica 68.46 2.00e-62 229.00
IUUC-Sly-111506 Solanum lycopersicum 68.46 9.00e-63 229.00
IUUC-Stu-112518 Solanum tuberosum 67.79 1.00e-62 230.00
IUUC-Sar-113429 Sorex araneus 71.14 7.00e-65 237.00
IUUC-Sbi-114289 Sorghum bicolor 68.46 2.00e-62 229.00
IUUC-Sre-115106 Sporisorium reilianum 73.15 6.00e-62 228.00
IUUC-Ssc-116265 Sus scrofa 70.39 6.00e-66 240.00
IUUC-Tgu-117383 Taeniopygia guttata 70.39 6.00e-66 240.00
IUUC-Tru-118576 Takifugu rubripes 71.14 4.00e-65 238.00
IUUC-Tsy-119000 Tarsius syrichta 71.14 7.00e-65 237.00
IUUC-Tni-119745 Tetraodon nigroviridis 71.14 4.00e-65 238.00
IUUC-Tca-121827 Theobroma cacao 69.13 7.00e-63 230.00
IUUC-Tre-122002 Trichoderma reesei 92.67 5.00e-83 297.00
IUUC-Tvi-122331 Trichoderma virens 92.67 5.00e-83 297.00
IUUC-Tae-124461 Triticum aestivum 67.79 3.00e-62 229.00
IUUC-Tur-126866 Triticum urartu 67.11 9.00e-62 226.00
IUUC-Tbe-127921 Tupaia belangeri 69.13 2.00e-60 222.00
IUUC-Ttr-129121 Tursiops truncatus 71.14 7.00e-65 237.00
IUUC-Uma-129561 Ustilago maydis 73.15 4.00e-62 228.00
IUUC-Vda-129711 Verticillium dahliae 92.67 2.00e-83 298.00
IUUC-Vpa-130570 Vicugna pacos 63.43 1.00e-50 189.00
IUUC-Vvi-131108 Vitis vinifera 68.46 5.00e-63 231.00
IUUC-Xtr-132301 Xenopus tropicalis 70.39 6.00e-66 240.00
IUUC-Xma-133937 Xiphophorus maculatus 70.39 6.00e-66 240.00
IUUC-Yli-134660 Yarrowia lipolytica 83.22 2.00e-76 275.00
IUUC-Zma-135584 Zea mays 67.11 7.00e-62 227.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved