• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Cin-025269
UUCD1 version UUC-CiI-00219
Ensembl Protein ID ENSCINP00000012690.3
UniProt Accession F6V304; F6V304_CIOIN
Protein Name Defective in cullin neddylation protein
Gene Name LOC100180811
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSCING00000006132.3 ENSCINT00000012690.3 ENSCINP00000012690.3
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 7.10e-78 260.8 60 248
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 1    vskkkleelferYkdpqed.ligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktlesel 88
    v+++kle+lf+ kdp + ++g+eg++kfce+l+v+p++ +vL++awk++aat+cef+++ef++g+++lgcd ++kl+ kl+ l +e+
   Q: 60 VERRKLEALFNALKDPLDPdKVGVEGISKFCEELQVEPTSRIVLIIAWKFRAATQCEFTKKEFFEGMMELGCDDLSKLRIKLPVLANEI 148
    5789************8755********************************************************************* PP
   S: 89 kdeqkfkdiYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaW 177
    d++kf+d+Y+f+fnfak++gqk+l+l++aia+w++ll++r f +ld+w ++Le + k++i++DtWnllL+fs++i++d+snYdeegaW
   Q: 149 TDKNKFRDFYQFTFNFAKNPGQKGLELEMAIAYWNILLSDR-FTFLDLWAEYLETHYKRAIPRDTWNLLLDFSQMISSDMSNYDEEGAW 236
    **************************************999.*********************************************** PP
   S: 178 PvliDefveylk 189
    PvliD+fve++k
   Q: 237 PVLIDDFVEWAK 248
    **********85 PP
   

Organism Ciona intestinalis
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MHKLKSSQRE KVRQFISLTN LSEKSAISCL AKHDWRLDIA SDSFFSEPES YVVSDRRSHV 60
ERRKLEALFN ALKDPLDPDK VGVEGISKFC EELQVEPTSR IVLIIAWKFR AATQCEFTKK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cin-025269|E3,DCUN1|Ciona intestinalis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGTTTTCTCG GTGTTTAACC AAATTGAAAA CCAATAGTCT ATCAATTTGA TTTATTTGGT 60
TAAAATCTCC AGTTTTGTAA ATGTTGCCAA GACAATATTT CACTTTAGTA AACTGACTGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cin-025269|E3,DCUN1|Ciona intestinalis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Gene Ontology

GO:0000151--C:ubiquitin ligase complex
GO:0097602--F:cullin family protein binding
GO:0031624--F:ubiquitin conjugating enzyme binding
GO:0032182--F:ubiquitin-like protein binding
GO:0051443--P:positive regulation of ubiquitin-protein transferase activity
GO:0045116--P:protein neddylation

KEGG cin:100180811
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 44.94 2.00e-61 227.00
IUUC-Aml-001879 Ailuropoda melanoleuca 61.09 1.00e-99 354.00
IUUC-Atr-002697 Amborella trichopoda 40.91 7.00e-25 104.00
IUUC-Apl-003933 Anas platyrhynchos 61.60 4.00e-99 352.00
IUUC-Aca-005269 Anolis carolinensis 61.24 2.00e-99 353.00
IUUC-Aly-006285 Arabidopsis lyrata 37.25 6.00e-48 182.00
IUUC-Ath-007531 Arabidopsis thaliana 43.72 2.00e-61 226.00
IUUC-Ago-007806 Ashbya gossypii 26.64 5.00e-20 89.70
IUUC-Acl-008172 Aspergillus clavatus 25.36 2.00e-23 101.00
IUUC-Afl-008569 Aspergillus flavus 27.00 9.00e-28 115.00
IUUC-Ani-009241 Aspergillus nidulans 24.84 1.00e-23 102.00
IUUC-Ang-009664 Aspergillus niger 27.73 3.00e-22 97.10
IUUC-Aor-009902 Aspergillus oryzae 27.42 1.00e-10 57.00
IUUC-Ate-010414 Aspergillus terreus 27.76 1.00e-28 118.00
IUUC-Ame-011763 Astyanax mexicanus 59.77 4.00e-97 345.00
IUUC-Bgr-011991 Blumeria graminis 30.77 6.00e-25 106.00
IUUC-Bta-013561 Bos taurus 60.17 2.00e-92 330.00
IUUC-Bci-013824 Botrytis cinerea 30.86 6.00e-28 116.00
IUUC-Bdi-014138 Brachypodium distachyon 45.75 2.00e-62 230.00
IUUC-Bol-015564 Brassica oleracea 43.32 1.00e-60 224.00
IUUC-Bra-017111 Brassica rapa 42.51 3.00e-59 219.00
IUUC-Cel-018441 Caenorhabditis elegans 36.76 2.00e-49 187.00
IUUC-Cja-019502 Callithrix jacchus 61.09 3.00e-99 353.00
IUUC-Cfa-020523 Canis familiaris 60.58 5.00e-93 332.00
IUUC-Cpo-022196 Cavia porcellus 61.09 2.00e-99 353.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 38.10 3.00e-48 184.00
IUUC-Csa-023551 Chlorocebus sabaeus 61.24 3.00e-100 356.00
IUUC-Cho-024373 Choloepus hoffmanni 60.70 3.00e-95 339.00
IUUC-Csv-026372 Ciona savignyi 56.39 3.00e-74 270.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 31.28 4.00e-23 99.40
IUUC-Cne-026950 Cryptococcus neoformans 29.81 2.00e-29 121.00
IUUC-Cme-027199 Cyanidioschyzon merolae 24.68 2.00e-08 52.00
IUUC-Dre-028247 Danio rerio 60.94 4.00e-99 352.00
IUUC-Dno-028974 Dasypus novemcinctus 61.24 3.00e-100 356.00
IUUC-Dor-030143 Dipodomys ordii 62.40 4.00e-98 348.00
IUUC-Dse-031365 Dothistroma septosporum 26.14 1.00e-24 105.00
IUUC-Dme-032197 Drosophila melanogaster 56.22 4.00e-84 303.00
IUUC-Ete-032371 Echinops telfairi 61.09 1.00e-99 354.00
IUUC-Eca-033242 Equus caballus 61.09 1.00e-99 353.00
IUUC-Eeu-035317 Erinaceus europaeus 61.48 7.00e-100 355.00
IUUC-Fca-036061 Felis catus 60.85 9.00e-100 354.00
IUUC-Fal-036715 Ficedula albicollis 61.20 1.00e-98 351.00
IUUC-Fox-037884 Fusarium oxysporum 35.45 1.00e-16 78.20
IUUC-Fso-038150 Fusarium solani 30.20 2.00e-20 91.30
IUUC-Gmo-038750 Gadus morhua 63.20 2.00e-100 356.00
IUUC-Ggr-039959 Gaeumannomyces graminis 25.47 1.00e-14 73.20
IUUC-Gga-040935 Gallus gallus 61.24 3.00e-100 355.00
IUUC-Gac-041478 Gasterosteus aculeatus 62.80 3.00e-100 356.00
IUUC-Gma-043545 Glycine max 42.51 4.00e-60 223.00
IUUC-Ggo-044972 Gorilla gorilla 62.15 3.00e-98 349.00
IUUC-Hsa-046089 Homo sapiens 61.24 3.00e-100 356.00
IUUC-Hvu-047636 Hordeum vulgare 40.16 4.00e-22 96.30
IUUC-Itr-047902 Ictidomys tridecemlineatus 61.60 9.00e-97 344.00
IUUC-Lch-050600 Latimeria chalumnae 63.35 2.00e-101 360.00
IUUC-Lpe-051540 Leersia perrieri 45.93 3.00e-63 233.00
IUUC-Loc-052509 Lepisosteus oculatus 62.55 4.00e-100 355.00
IUUC-Lma-053103 Leptosphaeria maculans 31.01 2.00e-32 131.00
IUUC-Laf-053972 Loxodonta africana 62.40 1.00e-99 354.00
IUUC-Mcc-054700 Macaca mulatta 62.15 1.00e-98 350.00
IUUC-Meu-056791 Macropus eugenii 52.40 1.00e-75 274.00
IUUC-Mor-056909 Magnaporthe oryzae 28.73 2.00e-26 111.00
IUUC-Mpo-057299 Magnaporthe poae 25.91 3.00e-20 90.50
IUUC-Mtr-057964 Medicago truncatula 42.11 3.00e-60 223.00
IUUC-Mla-058990 Melampsora laricipopulina 29.96 8.00e-22 96.30
IUUC-Mga-060072 Meleagris gallopavo 62.00 8.00e-100 354.00
IUUC-Mvi-060312 Microbotryum violaceum 33.46 4.00e-41 160.00
IUUC-Mmr-060851 Microcebus murinus 61.09 2.00e-99 353.00
IUUC-Mdo-063074 Monodelphis domestica 61.09 4.00e-100 357.00
IUUC-Mmu-063954 Mus musculus 60.85 1.00e-99 354.00
IUUC-Mac-065016 Musa acuminata 44.38 2.00e-44 170.00
IUUC-Mpu-066870 Mustela putorius furo 60.58 5.00e-93 332.00
IUUC-Mlu-067701 Myotis lucifugus 60.70 2.00e-98 350.00
IUUC-Ncr-068780 Neurospora crassa 24.00 1.00e-20 92.00
IUUC-Nle-069291 Nomascus leucogenys 61.24 3.00e-100 356.00
IUUC-Opr-070265 Ochotona princeps 45.91 9.00e-58 214.00
IUUC-Ont-071813 Oreochromis niloticus 64.00 2.00e-101 360.00
IUUC-Oan-073031 Ornithorhynchus anatinus 61.48 1.00e-99 354.00
IUUC-Ocu-074648 Oryctolagus cuniculus 61.09 1.00e-99 353.00
IUUC-Oba-074993 Oryza barthii 45.75 1.00e-63 234.00
IUUC-Obr-076341 Oryza brachyantha 45.75 2.00e-63 233.00
IUUC-Ogl-077099 Oryza glaberrima 45.75 1.00e-63 234.00
IUUC-Ogu-078285 Oryza glumaepatula 45.75 5.00e-63 232.00
IUUC-Oin-079441 Oryza indica 45.75 9.00e-64 234.00
IUUC-Olo-081037 Oryza longistaminata 45.75 9.00e-64 234.00
IUUC-Ome-081357 Oryza meridionalis 45.75 9.00e-64 234.00
IUUC-Oni-082632 Oryza nivara 45.75 8.00e-64 235.00
IUUC-Opu-083351 Oryza punctata 45.26 2.00e-58 217.00
IUUC-Oru-084306 Oryza rufipogon 45.75 9.00e-64 234.00
IUUC-Osa-085307 Oryza sativa 45.75 9.00e-64 234.00
IUUC-Ola-086371 Oryzias latipes 63.60 2.00e-101 360.00
IUUC-Olu-087646 Ostreococcus lucimarinus 36.84 5.00e-46 176.00
IUUC-Oga-089015 Otolemur garnettii 60.70 6.00e-99 352.00
IUUC-Oar-090405 Ovis aries 60.70 6.00e-99 352.00
IUUC-Ptr-090735 Pan troglodytes 61.09 1.00e-99 353.00
IUUC-Pan-092825 Papio anubis 62.15 1.00e-98 351.00
IUUC-Psi-093110 Pelodiscus sinensis 60.58 1.00e-92 330.00
IUUC-Pno-095145 Phaeosphaeria nodorum 30.20 4.00e-23 100.00
IUUC-Ppa-095321 Physcomitrella patens 40.96 2.00e-56 210.00
IUUC-Pfo-096813 Poecilia formosa 62.95 8.00e-99 352.00
IUUC-Pab-098197 Pongo abelii 60.59 2.00e-90 323.00
IUUC-Pop-098821 Populus trichocarpa 44.66 2.00e-25 106.00
IUUC-Pca-100218 Procavia capensis 60.31 6.00e-99 352.00
IUUC-Ppe-102032 Prunus persica 43.78 6.00e-63 232.00
IUUC-Pva-102691 Pteropus vampyrus 62.95 8.00e-101 358.00
IUUC-Pgr-103633 Puccinia graminis 28.17 1.00e-24 105.00
IUUC-Pyt-104428 Pyrenophora triticirepentis 33.01 2.00e-27 114.00
IUUC-Rno-105554 Rattus norvegicus 60.85 6.00e-100 355.00
IUUC-Sce-106358 Saccharomyces cerevisiae 24.90 6.00e-17 79.70
IUUC-Sha-106888 Sarcophilus harrisii 61.09 2.00e-99 353.00
IUUC-Spo-108207 Schizosaccharomyces pombe 30.37 8.00e-23 99.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 31.78 8.00e-30 122.00
IUUC-Smo-108750 Selaginella moellendorffii 39.92 5.00e-49 186.00
IUUC-Sit-110052 Setaria italica 45.38 1.00e-63 234.00
IUUC-Sly-111489 Solanum lycopersicum 42.28 2.00e-58 217.00
IUUC-Stu-112517 Solanum tuberosum 40.73 4.00e-58 216.00
IUUC-Sar-113509 Sorex araneus 44.36 2.00e-63 233.00
IUUC-Sbi-114113 Sorghum bicolor 44.98 4.00e-64 236.00
IUUC-Sre-115221 Sporisorium reilianum 28.52 2.00e-28 117.00
IUUC-Ssc-115547 Sus scrofa 61.24 3.00e-100 356.00
IUUC-Tgu-117147 Taeniopygia guttata 61.09 2.00e-99 353.00
IUUC-Tru-118316 Takifugu rubripes 62.06 4.00e-99 352.00
IUUC-Tsy-119599 Tarsius syrichta 61.09 1.00e-99 354.00
IUUC-Tni-120542 Tetraodon nigroviridis 62.35 4.00e-98 349.00
IUUC-Tca-121033 Theobroma cacao 41.70 9.00e-60 221.00
IUUC-Tre-121986 Trichoderma reesei 28.14 3.00e-20 90.90
IUUC-Tvi-122607 Trichoderma virens 28.96 2.00e-24 104.00
IUUC-Tae-125740 Triticum aestivum 38.54 2.00e-55 207.00
IUUC-Tur-126375 Triticum urartu 35.33 3.00e-52 197.00
IUUC-Tme-126878 Tuber melanosporum 39.27 5.00e-44 170.00
IUUC-Ttr-129086 Tursiops truncatus 54.09 1.00e-84 304.00
IUUC-Uma-129364 Ustilago maydis 30.39 1.00e-34 138.00
IUUC-Vda-129929 Verticillium dahliae 30.30 2.00e-20 92.00
IUUC-Vpa-130048 Vicugna pacos 51.36 1.00e-78 284.00
IUUC-Vvi-130834 Vitis vinifera 42.11 2.00e-59 221.00
IUUC-Xtr-131888 Xenopus tropicalis 62.26 4.00e-101 359.00
IUUC-Xma-133580 Xiphophorus maculatus 63.35 2.00e-101 360.00
IUUC-Yli-134595 Yarrowia lipolytica 30.17 1.00e-31 128.00
IUUC-Zma-135642 Zea mays 46.56 2.00e-64 237.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved