• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mtr-057964
Ensembl Protein ID KEH38235
UniProt Accession A0A072VJB0; A0A072VJB0_MEDTR
Genbank Protein ID KEH38235.1
Protein Name Defective in cullin neddylation protein
Genbank Nucleotide ID CM001218
Gene Name MTR_2g064415
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
MTR_2g064415 KEH38235 KEH38235
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 2.80e-80 270.3 55 241
UBD/Alpha-Helix/UBA 1.50e-06 29.6 10 46
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselkdeqkfkdiYrfaf 102
    ++++leel++rYkd++ d+i ++g++ +c+d++vdp+di++Lvl+w+++a t+cefs++ef +gl++lg+ds+ek++ek++ ++selkdeqkf++iY+faf
   Q: 55 DTRHLEELYNRYKDKYIDMIYADGITLLCNDIQVDPQDIVMLVLSWHMKAGTMCEFSKKEFTEGLQSLGIDSLEKFREKIPYMRSELKDEQKFREIYNFAF 155
    6799************************************************************************************************* PP
   S: 103 nfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaWPvliDefveyl 188
    +ak+kgqksl+ldtai +w+Ll+ae++++l+++w++fL+ +++k+is+DtW +lLef+k++++ ls+Yd+egaWP+liDefv+yl
   Q: 156 GWAKEKGQKSLALDTAIGMWQLLFAEKQWPLVEHWCQFLQARHNKAISRDTWSQLLEFAKTVSSNLSDYDAEGAWPYLIDEFVDYL 241
    ***********************************************************************************996 PP
   


   UBD/Alpha-Helix/UBA

   S: 5    dkleqlve.MGFdreealqaLraannnleaAveyLld 40
    dk++q+v +G +++ a qaL a+++nle A +y+++
   Q: 10 DKVQQFVTiTGASEKVAMQALKASDWNLEGAFDYFYS 46
    89*********************************97 PP
   

Organism Medicago truncatula
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MHKLGRGHRD KVQQFVTITG ASEKVAMQAL KASDWNLEGA FDYFYSQPQL RTFTDTRHLE 60
ELYNRYKDKY IDMIYADGIT LLCNDIQVDP QDIVMLVLSW HMKAGTMCEF SKKEFTEGLQ 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mtr-057964|E3,DCUN1;UBD,UBA|Medicago truncatula
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATTCATTCAA GATTTTGAAA GGTATCCAAA TCCAAATATT TTTAAACCAA AAGAATTGTT 60
TATACTCTTC TTATGCCTGC CTACTCGAAC ATAAGAAGAA ATCGAGGTAA GTAGGGTCCA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mtr-057964|E3,DCUN1;UBD,UBA|Medicago truncatula
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

KEGG mtr:MTR_2g064415
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 72.51 2.00e-115 407.00
IUUC-Aml-001879 Ailuropoda melanoleuca 41.87 2.00e-57 214.00
IUUC-Atr-002697 Amborella trichopoda 88.29 3.00e-57 213.00
IUUC-Apl-003933 Anas platyrhynchos 42.28 2.00e-57 215.00
IUUC-Aca-005269 Anolis carolinensis 40.89 2.00e-56 211.00
IUUC-Aly-006285 Arabidopsis lyrata 66.67 5.00e-94 336.00
IUUC-Ath-007531 Arabidopsis thaliana 74.49 4.00e-112 396.00
IUUC-Ago-007806 Ashbya gossypii 26.09 6.00e-18 83.60
IUUC-Acl-008172 Aspergillus clavatus 27.78 5.00e-25 107.00
IUUC-Afl-008569 Aspergillus flavus 28.69 2.00e-29 121.00
IUUC-Afu-009005 Aspergillus fumigatus 27.65 6.00e-19 86.30
IUUC-Ani-009241 Aspergillus nidulans 22.82 4.00e-19 87.80
IUUC-Ang-009664 Aspergillus niger 28.85 9.00e-27 112.00
IUUC-Aor-009902 Aspergillus oryzae 27.78 7.00e-11 58.90
IUUC-Ate-010414 Aspergillus terreus 27.49 3.00e-28 117.00
IUUC-Ame-011763 Astyanax mexicanus 42.28 2.00e-58 218.00
IUUC-Bgr-011991 Blumeria graminis 29.17 1.00e-18 86.30
IUUC-Bta-013561 Bos taurus 40.95 2.00e-52 197.00
IUUC-Bci-013824 Botrytis cinerea 32.14 1.00e-28 119.00
IUUC-Bdi-014138 Brachypodium distachyon 72.18 5.00e-113 399.00
IUUC-Bol-016110 Brassica oleracea 75.20 1.00e-113 401.00
IUUC-Bra-017111 Brassica rapa 76.02 2.00e-114 404.00
IUUC-Cel-018441 Caenorhabditis elegans 35.27 6.00e-41 160.00
IUUC-Cja-018854 Callithrix jacchus 42.28 6.00e-58 216.00
IUUC-Cfa-020523 Canis familiaris 41.38 5.00e-53 200.00
IUUC-Cpo-022196 Cavia porcellus 41.46 4.00e-57 213.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 43.25 4.00e-60 224.00
IUUC-Csa-023551 Chlorocebus sabaeus 42.11 3.00e-58 217.00
IUUC-Cho-024373 Choloepus hoffmanni 41.46 2.00e-53 201.00
IUUC-Cin-025269 Ciona intestinalis 42.11 5.00e-60 223.00
IUUC-Csv-025976 Ciona savignyi 36.26 1.00e-32 132.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 31.61 3.00e-21 94.40
IUUC-Cne-026950 Cryptococcus neoformans 33.46 1.00e-33 135.00
IUUC-Cme-027199 Cyanidioschyzon merolae 31.97 1.00e-08 53.50
IUUC-Dre-028247 Danio rerio 42.68 7.00e-59 219.00
IUUC-Dno-028974 Dasypus novemcinctus 42.11 3.00e-58 217.00
IUUC-Dor-030143 Dipodomys ordii 42.68 3.00e-58 218.00
IUUC-Dse-031365 Dothistroma septosporum 27.42 5.00e-25 107.00
IUUC-Dme-032197 Drosophila melanogaster 38.91 3.00e-53 201.00
IUUC-Ete-032371 Echinops telfairi 41.87 2.00e-57 214.00
IUUC-Eca-033242 Equus caballus 41.87 2.00e-57 214.00
IUUC-Eeu-035317 Erinaceus europaeus 41.46 4.00e-57 213.00
IUUC-Fca-036061 Felis catus 41.70 1.00e-57 215.00
IUUC-Fal-036715 Ficedula albicollis 42.28 1.00e-57 215.00
IUUC-Fox-037884 Fusarium oxysporum 30.92 1.00e-15 75.50
IUUC-Fso-038150 Fusarium solani 26.70 1.00e-15 76.60
IUUC-Gmo-038750 Gadus morhua 43.50 2.00e-58 218.00
IUUC-Ggr-039959 Gaeumannomyces graminis 26.79 5.00e-15 75.50
IUUC-Gga-040935 Gallus gallus 42.11 4.00e-58 217.00
IUUC-Gac-041937 Gasterosteus aculeatus 42.28 2.00e-58 218.00
IUUC-Gma-043545 Glycine max 91.89 7.00e-145 505.00
IUUC-Ggo-044972 Gorilla gorilla 42.11 6.00e-58 216.00
IUUC-Hsa-046089 Homo sapiens 42.11 3.00e-58 217.00
IUUC-Hvu-047636 Hordeum vulgare 34.81 4.00e-20 90.50
IUUC-Itr-047902 Ictidomys tridecemlineatus 42.68 3.00e-57 214.00
IUUC-Kpa-049127 Komagataella pastoris 29.08 5.00e-26 110.00
IUUC-Lch-049751 Latimeria chalumnae 42.51 3.00e-58 217.00
IUUC-Lpe-051540 Leersia perrieri 74.09 7.00e-116 409.00
IUUC-Loc-052509 Lepisosteus oculatus 42.51 1.00e-58 219.00
IUUC-Lma-053103 Leptosphaeria maculans 27.78 3.00e-24 105.00
IUUC-Laf-053972 Loxodonta africana 43.50 4.00e-59 220.00
IUUC-Mcc-054700 Macaca mulatta 42.11 5.00e-58 216.00
IUUC-Meu-056791 Macropus eugenii 36.33 1.00e-43 169.00
IUUC-Mor-056909 Magnaporthe oryzae 27.97 1.00e-23 103.00
IUUC-Mpo-057299 Magnaporthe poae 27.14 2.00e-18 85.50
IUUC-Mla-058990 Melampsora laricipopulina 24.00 7.00e-15 73.90
IUUC-Mga-060072 Meleagris gallopavo 42.68 9.00e-58 216.00
IUUC-Mvi-060312 Microbotryum violaceum 34.68 9.00e-41 159.00
IUUC-Mmr-060851 Microcebus murinus 41.87 3.00e-57 214.00
IUUC-Mdo-063074 Monodelphis domestica 41.87 6.00e-57 215.00
IUUC-Mmu-063816 Mus musculus 42.51 5.00e-59 220.00
IUUC-Mac-065016 Musa acuminata 82.97 1.00e-91 327.00
IUUC-Mpu-066870 Mustela putorius furo 41.38 5.00e-53 200.00
IUUC-Mlu-067701 Myotis lucifugus 41.46 2.00e-56 211.00
IUUC-Nfi-068610 Neosartorya fischeri 28.24 6.00e-19 86.30
IUUC-Ncr-068780 Neurospora crassa 24.09 4.00e-18 84.30
IUUC-Nle-069291 Nomascus leucogenys 42.11 3.00e-58 217.00
IUUC-Opr-070682 Ochotona princeps 39.36 2.00e-41 162.00
IUUC-Ont-071813 Oreochromis niloticus 43.09 7.00e-59 219.00
IUUC-Oan-073031 Ornithorhynchus anatinus 41.46 5.00e-57 213.00
IUUC-Ocu-074648 Oryctolagus cuniculus 41.87 2.00e-57 214.00
IUUC-Oba-074993 Oryza barthii 74.19 1.00e-116 411.00
IUUC-Obr-076341 Oryza brachyantha 72.98 7.00e-115 405.00
IUUC-Ogl-077099 Oryza glaberrima 74.19 1.00e-116 411.00
IUUC-Ogu-078285 Oryza glumaepatula 75.00 1.00e-117 414.00
IUUC-Oin-079441 Oryza indica 74.60 3.00e-117 413.00
IUUC-Olo-081037 Oryza longistaminata 74.60 3.00e-117 413.00
IUUC-Ome-081357 Oryza meridionalis 74.60 3.00e-117 413.00
IUUC-Oni-082632 Oryza nivara 74.19 2.00e-116 410.00
IUUC-Opu-083351 Oryza punctata 73.39 2.00e-108 384.00
IUUC-Oru-084306 Oryza rufipogon 74.60 3.00e-117 413.00
IUUC-Osa-085307 Oryza sativa 74.60 3.00e-117 413.00
IUUC-Ola-086868 Oryzias latipes 42.68 3.00e-59 221.00
IUUC-Olu-087646 Ostreococcus lucimarinus 43.50 6.00e-54 203.00
IUUC-Oga-088621 Otolemur garnettii 42.28 2.00e-57 214.00
IUUC-Oar-090405 Ovis aries 41.46 8.00e-57 212.00
IUUC-Ptr-090735 Pan troglodytes 41.87 2.00e-57 214.00
IUUC-Pan-092825 Papio anubis 42.11 3.00e-58 217.00
IUUC-Psi-093110 Pelodiscus sinensis 41.38 1.00e-52 199.00
IUUC-Pma-094196 Petromyzon marinus 37.63 3.00e-41 161.00
IUUC-Pno-095145 Phaeosphaeria nodorum 28.28 2.00e-19 89.00
IUUC-Ppa-095306 Physcomitrella patens 73.17 1.00e-112 398.00
IUUC-Pfo-097121 Poecilia formosa 41.87 2.00e-59 222.00
IUUC-Pab-098197 Pongo abelii 40.95 4.00e-52 197.00
IUUC-Pop-098821 Populus trichocarpa 86.18 5.00e-61 224.00
IUUC-Pca-100218 Procavia capensis 40.24 5.00e-56 210.00
IUUC-Ppe-102032 Prunus persica 85.48 1.00e-130 458.00
IUUC-Pva-102691 Pteropus vampyrus 42.91 5.00e-59 220.00
IUUC-Pgr-103633 Puccinia graminis 27.62 9.00e-20 90.10
IUUC-Ptt-103979 Puccinia triticina 31.94 3.00e-04 38.90
IUUC-Pyt-104428 Pyrenophora triticirepentis 26.89 6.00e-20 90.50
IUUC-Rno-105016 Rattus norvegicus 42.91 4.00e-59 220.00
IUUC-Sce-106358 Saccharomyces cerevisiae 26.62 2.00e-21 95.10
IUUC-Sha-106542 Sarcophilus harrisii 42.11 2.00e-57 215.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.63 2.00e-21 95.10
IUUC-Spo-108207 Schizosaccharomyces pombe 33.84 1.00e-24 105.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 31.37 3.00e-29 121.00
IUUC-Smo-108750 Selaginella moellendorffii 65.98 7.00e-96 342.00
IUUC-Sit-110052 Setaria italica 76.10 9.00e-119 418.00
IUUC-Sly-111489 Solanum lycopersicum 81.32 3.00e-126 443.00
IUUC-Stu-112517 Solanum tuberosum 63.41 2.00e-97 347.00
IUUC-Sar-113509 Sorex araneus 42.44 4.00e-38 150.00
IUUC-Sbi-114113 Sorghum bicolor 74.70 6.00e-116 409.00
IUUC-Sre-115221 Sporisorium reilianum 24.74 2.00e-22 98.60
IUUC-Ssc-115547 Sus scrofa 42.11 3.00e-58 217.00
IUUC-Tgu-117196 Taeniopygia guttata 42.28 1.00e-57 215.00
IUUC-Tru-117740 Takifugu rubripes 42.45 1.00e-58 218.00
IUUC-Tsy-119599 Tarsius syrichta 41.87 2.00e-57 214.00
IUUC-Tni-120542 Tetraodon nigroviridis 43.15 2.00e-57 214.00
IUUC-Tca-121033 Theobroma cacao 85.71 8.00e-136 475.00
IUUC-Tre-121986 Trichoderma reesei 23.83 6.00e-19 87.40
IUUC-Tvi-122607 Trichoderma virens 28.79 2.00e-24 105.00
IUUC-Tae-125740 Triticum aestivum 62.33 8.00e-110 389.00
IUUC-Tur-126375 Triticum urartu 56.92 5.00e-104 370.00
IUUC-Tme-126878 Tuber melanosporum 31.89 7.00e-34 137.00
IUUC-Tbe-127429 Tupaia belangeri 39.36 2.00e-41 162.00
IUUC-Ttr-129086 Tursiops truncatus 38.62 2.00e-49 188.00
IUUC-Uma-129364 Ustilago maydis 26.37 9.00e-28 116.00
IUUC-Vda-129929 Verticillium dahliae 30.85 9.00e-19 87.40
IUUC-Vpa-130048 Vicugna pacos 36.18 1.00e-43 169.00
IUUC-Vvi-130834 Vitis vinifera 84.17 1.00e-133 468.00
IUUC-Xtr-131888 Xenopus tropicalis 41.06 2.00e-57 214.00
IUUC-Xma-134122 Xiphophorus maculatus 42.28 2.00e-60 224.00
IUUC-Yli-134595 Yarrowia lipolytica 29.96 7.00e-31 126.00
IUUC-Zma-135642 Zea mays 73.90 7.00e-115 405.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved