• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Opu-083351
Ensembl Protein ID OPUNC06G08220.2
UniProt Accession A0A0E0L9Q2; A0A0E0L9Q2_ORYPU
Protein Name Defective in cullin neddylation protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
OPUNC06G08220 OPUNC06G08220.1 OPUNC06G08220.1
OPUNC06G08220 OPUNC06G08220.2 OPUNC06G08220.2
OPUNC06G08220 OPUNC06G08220.3 OPUNC06G08220.3
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 5.10e-84 281.9 39 225
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselkdeqkfk 95
    ++++le+l++rYk+p+ d+i +eg+++fc dl+vdp+di++Lv++w+++aat+cef+r+ef+ gl+++g+dsiekl+ekl++l+ e+kd +kf+
   Q: 39 NSRHLEDLYNRYKEPDVDMIMVEGVSQFCTDLQVDPQDIVMLVISWHMKAATMCEFTRQEFIGGLQSIGVDSIEKLREKLPSLRAEIKDDHKFR 132
    5799****************************************************************************************** PP
   S: 96 diYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaWPvliDefveyl 188
    +iY+faf +a++kgqksl+l+ta+ +w+Ll+aer+++l+d+w++fL+ +++k+is+DtW +lLef k+i+++lsnYdeegaWP+liDefveyl
   Q: 133 EIYNFAFAWAREKGQKSLALETALGMWQLLFAERHWPLIDHWCQFLQVRHNKAISRDTWSQLLEFVKTIDPQLSNYDEEGAWPYLIDEFVEYL 225
    *******************************************************************************************96 PP
   

Organism Oryza punctata
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MTITGASEKV ALQALKASDW HLEGAFDFFY SQPQISVTNS RHLEDLYNRY KEPDVDMIMV 60
EGVSQFCTDL QVDPQDIVML VISWHMKAAT MCEFTRQEFI GGLQSIGVDS IEKLREKLPS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Opu-083351|E3,DCUN1|Oryza punctata
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CATAAGCTGG GGAGAGGAAG CCGCGACAAG GTGCAGCAGT TCATGACCAT AACTGGCGCG 60
AGGTGGGATC GTTTATTTGC TCCCGAACTC TAGACCTGCG GTATTTTTAG GATTGGAAAT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Opu-083351|E3,DCUN1|Oryza punctata
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 92.67 3.00e-129 453.00
IUUC-Aml-001879 Ailuropoda melanoleuca 43.97 1.00e-57 215.00
IUUC-Atr-002697 Amborella trichopoda 72.44 4.00e-53 199.00
IUUC-Apl-003933 Anas platyrhynchos 44.83 9.00e-57 212.00
IUUC-Aca-005269 Anolis carolinensis 44.40 5.00e-57 213.00
IUUC-Aly-006285 Arabidopsis lyrata 65.09 2.00e-85 307.00
IUUC-Ath-007531 Arabidopsis thaliana 71.79 1.00e-101 362.00
IUUC-Ago-007806 Ashbya gossypii 24.22 2.00e-18 85.10
IUUC-Acl-008172 Aspergillus clavatus 28.08 2.00e-27 115.00
IUUC-Afl-008569 Aspergillus flavus 32.08 2.00e-33 135.00
IUUC-Afu-009005 Aspergillus fumigatus 29.48 1.00e-21 95.50
IUUC-Ani-009241 Aspergillus nidulans 30.65 7.00e-24 103.00
IUUC-Ang-009664 Aspergillus niger 30.00 1.00e-29 122.00
IUUC-Aor-009902 Aspergillus oryzae 27.91 6.00e-12 62.40
IUUC-Ate-010414 Aspergillus terreus 30.00 2.00e-31 128.00
IUUC-Ame-011763 Astyanax mexicanus 45.89 1.00e-58 218.00
IUUC-Bgr-011991 Blumeria graminis 31.46 4.00e-23 100.00
IUUC-Bta-013561 Bos taurus 43.53 6.00e-57 213.00
IUUC-Bci-013824 Botrytis cinerea 33.61 8.00e-31 126.00
IUUC-Bdi-014138 Brachypodium distachyon 90.64 1.00e-128 451.00
IUUC-Bol-015564 Brassica oleracea 71.24 8.00e-101 358.00
IUUC-Bra-017111 Brassica rapa 71.24 5.00e-101 359.00
IUUC-Cel-018441 Caenorhabditis elegans 33.33 7.00e-38 150.00
IUUC-Cja-019502 Callithrix jacchus 43.97 1.00e-57 215.00
IUUC-Cfa-020523 Canis familiaris 43.97 1.00e-57 215.00
IUUC-Cpo-022196 Cavia porcellus 43.53 3.00e-57 214.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 50.00 3.00e-66 244.00
IUUC-Csa-023551 Chlorocebus sabaeus 43.97 1.00e-57 215.00
IUUC-Cho-024373 Choloepus hoffmanni 43.53 5.00e-54 203.00
IUUC-Cin-025269 Ciona intestinalis 45.26 4.00e-58 217.00
IUUC-Csv-025976 Ciona savignyi 36.77 5.00e-35 140.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 30.56 8.00e-22 95.90
IUUC-Cne-026950 Cryptococcus neoformans 33.98 3.00e-36 144.00
IUUC-Cme-027199 Cyanidioschyzon merolae 29.45 2.00e-08 52.40
IUUC-Dre-028247 Danio rerio 45.89 1.00e-58 219.00
IUUC-Dno-029524 Dasypus novemcinctus 46.55 1.00e-57 215.00
IUUC-Dor-030143 Dipodomys ordii 46.55 9.00e-58 216.00
IUUC-Dse-031365 Dothistroma septosporum 26.17 3.00e-25 108.00
IUUC-Dme-032197 Drosophila melanogaster 41.28 1.00e-53 202.00
IUUC-Ete-032371 Echinops telfairi 43.97 1.00e-57 215.00
IUUC-Eca-033242 Equus caballus 43.97 1.00e-57 215.00
IUUC-Eeu-035317 Erinaceus europaeus 44.40 6.00e-58 216.00
IUUC-Fca-036061 Felis catus 43.97 2.00e-57 215.00
IUUC-Fal-036715 Ficedula albicollis 44.83 7.00e-57 213.00
IUUC-Fox-037884 Fusarium oxysporum 32.68 4.00e-17 80.50
IUUC-Fso-038150 Fusarium solani 30.43 3.00e-20 91.70
IUUC-Gmo-038885 Gadus morhua 45.45 5.00e-59 220.00
IUUC-Ggr-039959 Gaeumannomyces graminis 27.75 1.00e-16 81.30
IUUC-Gga-040224 Gallus gallus 45.26 3.00e-57 214.00
IUUC-Gac-041937 Gasterosteus aculeatus 44.59 3.00e-57 214.00
IUUC-Gma-043545 Glycine max 76.39 4.00e-112 396.00
IUUC-Ggo-044972 Gorilla gorilla 44.83 8.00e-57 213.00
IUUC-Hsa-046089 Homo sapiens 43.97 1.00e-57 215.00
IUUC-Hvu-047636 Hordeum vulgare 37.60 2.00e-21 94.40
IUUC-Itr-047902 Ictidomys tridecemlineatus 46.12 7.00e-58 216.00
IUUC-Kpa-049127 Komagataella pastoris 28.45 6.00e-28 117.00
IUUC-Lch-050600 Latimeria chalumnae 46.12 1.00e-59 222.00
IUUC-Lpe-051540 Leersia perrieri 98.72 1.00e-139 487.00
IUUC-Loc-052509 Lepisosteus oculatus 45.26 4.00e-58 216.00
IUUC-Lma-053103 Leptosphaeria maculans 30.81 1.00e-27 115.00
IUUC-Laf-053972 Loxodonta africana 46.98 4.00e-58 217.00
IUUC-Mcc-054700 Macaca mulatta 44.83 6.00e-57 213.00
IUUC-Meu-056535 Macropus eugenii 43.46 2.00e-45 175.00
IUUC-Mor-056909 Magnaporthe oryzae 29.02 9.00e-24 103.00
IUUC-Mpo-057299 Magnaporthe poae 27.95 7.00e-20 90.50
IUUC-Mtr-057964 Medicago truncatula 73.39 3.00e-108 384.00
IUUC-Mla-058990 Melampsora laricipopulina 27.27 7.00e-18 84.00
IUUC-Mga-060072 Meleagris gallopavo 45.26 4.00e-57 213.00
IUUC-Mvi-060312 Microbotryum violaceum 35.89 7.00e-40 156.00
IUUC-Mmr-060851 Microcebus murinus 43.97 2.00e-57 214.00
IUUC-Mdo-063074 Monodelphis domestica 43.97 5.00e-57 215.00
IUUC-Mmu-063816 Mus musculus 45.26 2.00e-57 215.00
IUUC-Mac-065016 Musa acuminata 82.22 8.00e-92 328.00
IUUC-Mpu-066870 Mustela putorius furo 43.97 1.00e-57 215.00
IUUC-Mlu-067701 Myotis lucifugus 43.53 1.00e-56 212.00
IUUC-Nfi-068610 Neosartorya fischeri 29.48 1.00e-21 95.50
IUUC-Ncr-068780 Neurospora crassa 22.26 4.00e-15 74.70
IUUC-Nle-069291 Nomascus leucogenys 43.97 1.00e-57 215.00
IUUC-Opr-070682 Ochotona princeps 44.15 5.00e-46 177.00
IUUC-Ont-071408 Oreochromis niloticus 45.02 3.00e-58 217.00
IUUC-Oan-073031 Ornithorhynchus anatinus 44.40 8.00e-58 216.00
IUUC-Ocu-074648 Oryctolagus cuniculus 43.97 1.00e-57 215.00
IUUC-Oba-074993 Oryza barthii 98.72 2.00e-139 487.00
IUUC-Obr-076341 Oryza brachyantha 96.17 5.00e-137 479.00
IUUC-Ogl-077099 Oryza glaberrima 98.72 2.00e-139 487.00
IUUC-Ogu-078285 Oryza glumaepatula 98.30 2.00e-138 483.00
IUUC-Oin-079441 Oryza indica 99.15 5.00e-140 489.00
IUUC-Olo-081037 Oryza longistaminata 99.15 5.00e-140 489.00
IUUC-Ome-081357 Oryza meridionalis 99.15 5.00e-140 489.00
IUUC-Oni-082632 Oryza nivara 98.72 2.00e-139 487.00
IUUC-Oru-084306 Oryza rufipogon 99.15 5.00e-140 489.00
IUUC-Osa-085307 Oryza sativa 99.15 5.00e-140 489.00
IUUC-Ola-086371 Oryzias latipes 45.26 7.00e-58 216.00
IUUC-Olu-087646 Ostreococcus lucimarinus 41.59 2.00e-48 184.00
IUUC-Oga-089015 Otolemur garnettii 43.53 5.00e-57 213.00
IUUC-Oar-090405 Ovis aries 43.53 5.00e-57 213.00
IUUC-Ptr-090735 Pan troglodytes 43.97 1.00e-57 215.00
IUUC-Pan-092825 Papio anubis 44.83 4.00e-57 213.00
IUUC-Psi-093110 Pelodiscus sinensis 43.53 1.00e-56 212.00
IUUC-Pma-094196 Petromyzon marinus 40.86 2.00e-44 172.00
IUUC-Pno-095145 Phaeosphaeria nodorum 30.30 7.00e-25 107.00
IUUC-Ppa-095321 Physcomitrella patens 75.32 5.00e-106 376.00
IUUC-Pfo-097121 Poecilia formosa 44.83 1.00e-58 219.00
IUUC-Pab-098197 Pongo abelii 44.83 8.00e-57 213.00
IUUC-Pop-098821 Populus trichocarpa 79.46 1.00e-54 204.00
IUUC-Pca-100218 Procavia capensis 43.10 4.00e-57 213.00
IUUC-Ppe-102032 Prunus persica 75.97 5.00e-112 396.00
IUUC-Pva-102691 Pteropus vampyrus 45.26 3.00e-57 214.00
IUUC-Pgr-103633 Puccinia graminis 27.34 7.00e-22 97.10
IUUC-Ptt-103979 Puccinia triticina 35.71 5.00e-05 41.60
IUUC-Pyt-104428 Pyrenophora triticirepentis 29.52 1.00e-25 108.00
IUUC-Rno-105016 Rattus norvegicus 45.69 7.00e-58 216.00
IUUC-Sce-106358 Saccharomyces cerevisiae 24.60 2.00e-18 85.50
IUUC-Sha-106888 Sarcophilus harrisii 43.97 1.00e-57 215.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.95 1.00e-21 95.90
IUUC-Spo-108207 Schizosaccharomyces pombe 34.50 2.00e-27 115.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 33.33 5.00e-32 130.00
IUUC-Smo-108750 Selaginella moellendorffii 64.76 2.00e-84 304.00
IUUC-Sit-110613 Setaria italica 91.03 2.00e-130 457.00
IUUC-Sly-111489 Solanum lycopersicum 77.35 1.00e-113 401.00
IUUC-Stu-112517 Solanum tuberosum 63.04 2.00e-91 328.00
IUUC-Sar-113248 Sorex araneus 43.92 4.00e-40 157.00
IUUC-Sbi-114082 Sorghum bicolor 89.32 2.00e-128 450.00
IUUC-Sre-115221 Sporisorium reilianum 27.76 9.00e-26 110.00
IUUC-Ssc-115547 Sus scrofa 43.97 1.00e-57 215.00
IUUC-Tgu-117196 Taeniopygia guttata 45.26 5.00e-57 213.00
IUUC-Tru-117740 Takifugu rubripes 45.02 6.00e-58 216.00
IUUC-Tsy-119599 Tarsius syrichta 43.97 1.00e-57 215.00
IUUC-Tni-120542 Tetraodon nigroviridis 44.83 8.00e-57 213.00
IUUC-Tca-121033 Theobroma cacao 76.39 1.00e-112 398.00
IUUC-Tre-121986 Trichoderma reesei 31.38 1.00e-20 93.20
IUUC-Tvi-122607 Trichoderma virens 31.20 2.00e-25 108.00
IUUC-Tae-125740 Triticum aestivum 78.75 1.00e-123 434.00
IUUC-Tur-126375 Triticum urartu 70.96 1.00e-119 422.00
IUUC-Tme-126878 Tuber melanosporum 33.48 8.00e-35 140.00
IUUC-Tbe-127429 Tupaia belangeri 42.93 3.00e-46 178.00
IUUC-Ttr-129086 Tursiops truncatus 39.66 1.00e-48 185.00
IUUC-Uma-129364 Ustilago maydis 29.35 1.00e-32 132.00
IUUC-Vda-129929 Verticillium dahliae 30.89 6.00e-21 94.70
IUUC-Vpa-130048 Vicugna pacos 37.50 6.00e-44 170.00
IUUC-Vvi-130834 Vitis vinifera 77.68 2.00e-112 397.00
IUUC-Xtr-131888 Xenopus tropicalis 43.97 4.00e-58 216.00
IUUC-Xma-134122 Xiphophorus maculatus 43.97 2.00e-58 218.00
IUUC-Yli-134595 Yarrowia lipolytica 33.90 3.00e-37 147.00
IUUC-Zma-135642 Zea mays 90.17 6.00e-130 455.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved