• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Vvi-130834
UUCD1 version UUC-ViV-00606
Ensembl Protein ID VIT_19s0085g00630.t01
UniProt Accession F6H9U8; F6H9U8_VITVI
Genbank Protein ID CCB48991.1
Protein Name Defective in cullin neddylation protein
Genbank Nucleotide ID FN595503
Gene Name VIT_19s0085g00630
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
VIT_19s0085g00630 VIT_19s0085g00630.t01 VIT_19s0085g00630.t01
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 9.10e-84 280.8 55 241
UBD/Alpha-Helix/UBA 5.10e-06 27.0 10 46
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselk 89
    ++++leel++rYkdp+ d+i ++g++ +c+dl+vdp+di++Lv++w+++aat+cefs++ef++gl+alg+ds+ek++e+++++++elk
   Q: 55 DSRHLEELYSRYKDPYVDMIMADGISVLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFISGLQALGIDSLEKFRERIQFMRTELK 142
    6899************************************************************************************ PP
   S: 90 deqkfkdiYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaW 177
    deqkf++iY+faf +ak+kgqksl+ldtai +w+Ll+ae+++ l+d+w++fL+ +++k+is+DtW +lLef+k++++ lsnYd+egaW
   Q: 143 DEQKFREIYNFAFGWAKEKGQKSLALDTAIGMWQLLFAEKQWALVDHWCQFLQARHNKAISRDTWSQLLEFAKTVDPSLSNYDAEGAW 230
    **************************************************************************************** PP
   S: 178 PvliDefveyl 188
    P+liDefveyl
   Q: 231 PYLIDEFVEYL 241
    *********97 PP
   


   UBD/Alpha-Helix/UBA

   S: 5    dkleqlve.MGFdreealqaLraannnleaAveyLld 40
    dk++q+++ +G +++ al aL a++++le A + +++
   Q: 10 DKVQQFMAiTGASEKVALHALKASDWHLEGAFDVFYS 46
    89*****************************998876 PP
   

Organism Vitis vinifera
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MHKLGRGHRD KVQQFMAITG ASEKVALHAL KASDWHLEGA FDVFYSQPQI KAFTDSRHLE 60
ELYSRYKDPY VDMIMADGIS VLCNDLQVDP QDIVMLVVSW HMKAATMCEF SKQEFISGLQ 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Vvi-130834|E3,DCUN1;UBD,UBA|Vitis vinifera
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GTGCAAAAAA ATAGTGTGTT CTAGAGAGAG AAAAACCCGG AAACCCTAGT TTCTCTCTCT 60
AGAATTTCTC ACACAACCCA TCAACCATCT CTCATATATT CGGTTTCCTT CTCCAAATTC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Vvi-130834|E3,DCUN1;UBD,UBA|Vitis vinifera
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Gene Ontology

GO:0000151--C:ubiquitin ligase complex
GO:0097602--F:cullin family protein binding
GO:0031624--F:ubiquitin conjugating enzyme binding
GO:0032182--F:ubiquitin-like protein binding
GO:0051443--P:positive regulation of ubiquitin-protein transferase activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 76.89 2.00e-119 421.00
IUUC-Aml-001879 Ailuropoda melanoleuca 44.31 6.00e-60 223.00
IUUC-Atr-002697 Amborella trichopoda 90.09 4.00e-57 211.00
IUUC-Apl-003933 Anas platyrhynchos 44.72 3.00e-60 224.00
IUUC-Aca-005269 Anolis carolinensis 42.91 2.00e-58 218.00
IUUC-Aly-006285 Arabidopsis lyrata 68.67 2.00e-98 350.00
IUUC-Ath-007531 Arabidopsis thaliana 77.60 5.00e-118 416.00
IUUC-Ago-007806 Ashbya gossypii 27.20 4.00e-19 87.40
IUUC-Acl-008172 Aspergillus clavatus 26.59 2.00e-23 102.00
IUUC-Afl-008569 Aspergillus flavus 28.92 7.00e-30 123.00
IUUC-Afu-009005 Aspergillus fumigatus 27.06 8.00e-19 85.90
IUUC-Ani-009241 Aspergillus nidulans 22.15 8.00e-20 90.10
IUUC-Ang-009664 Aspergillus niger 28.12 4.00e-26 110.00
IUUC-Aor-009902 Aspergillus oryzae 29.25 4.00e-11 59.30
IUUC-Ate-010414 Aspergillus terreus 27.09 9.00e-28 115.00
IUUC-Ame-011763 Astyanax mexicanus 45.12 3.00e-61 227.00
IUUC-Bgr-011991 Blumeria graminis 32.99 8.00e-21 93.20
IUUC-Bta-013561 Bos taurus 44.40 9.00e-56 209.00
IUUC-Bci-013824 Botrytis cinerea 33.47 4.00e-31 127.00
IUUC-Bdi-014138 Brachypodium distachyon 74.70 1.00e-115 408.00
IUUC-Bol-015564 Brassica oleracea 77.11 4.00e-118 416.00
IUUC-Bra-017111 Brassica rapa 77.51 1.00e-118 418.00
IUUC-Cel-018441 Caenorhabditis elegans 34.18 1.00e-41 162.00
IUUC-Cja-018854 Callithrix jacchus 44.31 2.00e-60 224.00
IUUC-Cfa-020523 Canis familiaris 43.97 2.00e-55 207.00
IUUC-Cpo-021832 Cavia porcellus 43.95 2.00e-59 221.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 45.31 8.00e-64 236.00
IUUC-Csa-023551 Chlorocebus sabaeus 44.53 1.00e-60 224.00
IUUC-Cho-024373 Choloepus hoffmanni 43.90 5.00e-56 209.00
IUUC-Cin-025269 Ciona intestinalis 42.11 2.00e-59 221.00
IUUC-Csv-025976 Ciona savignyi 33.93 8.00e-35 139.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 32.56 1.00e-21 95.10
IUUC-Cne-026950 Cryptococcus neoformans 35.32 2.00e-35 142.00
IUUC-Cme-027199 Cyanidioschyzon merolae 29.92 3.00e-09 55.10
IUUC-Dre-028247 Danio rerio 45.12 3.00e-61 227.00
IUUC-Dno-028974 Dasypus novemcinctus 44.53 1.00e-60 224.00
IUUC-Dor-030143 Dipodomys ordii 44.72 6.00e-61 226.00
IUUC-Dse-031365 Dothistroma septosporum 27.82 5.00e-25 107.00
IUUC-Dme-032197 Drosophila melanogaster 40.16 3.00e-56 211.00
IUUC-Ete-032371 Echinops telfairi 44.31 6.00e-60 223.00
IUUC-Eca-033242 Equus caballus 44.31 6.00e-60 223.00
IUUC-Eeu-035317 Erinaceus europaeus 43.90 1.00e-59 221.00
IUUC-Fca-036061 Felis catus 44.13 4.00e-60 223.00
IUUC-Fal-036715 Ficedula albicollis 44.72 2.00e-60 224.00
IUUC-Fox-037884 Fusarium oxysporum 27.93 8.00e-15 72.40
IUUC-Fso-038150 Fusarium solani 28.57 1.00e-16 79.30
IUUC-Gmo-038750 Gadus morhua 45.12 3.00e-60 224.00
IUUC-Ggr-039959 Gaeumannomyces graminis 29.02 1.00e-16 80.50
IUUC-Gga-040935 Gallus gallus 44.13 4.00e-60 223.00
IUUC-Gac-041478 Gasterosteus aculeatus 44.31 1.00e-59 222.00
IUUC-Gma-043545 Glycine max 86.49 3.00e-135 473.00
IUUC-Ggo-044972 Gorilla gorilla 44.13 2.00e-60 224.00
IUUC-Hsa-046994 Homo sapiens 44.13 8.00e-61 225.00
IUUC-Hvu-047636 Hordeum vulgare 36.00 7.00e-21 92.40
IUUC-Itr-047902 Ictidomys tridecemlineatus 44.72 7.00e-60 222.00
IUUC-Kpa-049127 Komagataella pastoris 28.29 7.00e-27 113.00
IUUC-Lch-049751 Latimeria chalumnae 44.53 2.00e-60 224.00
IUUC-Lpe-051540 Leersia perrieri 78.14 4.00e-120 422.00
IUUC-Loc-052509 Lepisosteus oculatus 44.94 5.00e-61 226.00
IUUC-Lma-053103 Leptosphaeria maculans 28.57 1.00e-26 112.00
IUUC-Laf-053972 Loxodonta africana 45.12 6.00e-61 226.00
IUUC-Mcc-054700 Macaca mulatta 44.13 1.00e-60 225.00
IUUC-Meu-056791 Macropus eugenii 36.72 6.00e-44 169.00
IUUC-Mor-056909 Magnaporthe oryzae 28.36 4.00e-24 103.00
IUUC-Mpo-057299 Magnaporthe poae 28.15 1.00e-20 92.80
IUUC-Mtr-057964 Medicago truncatula 84.17 1.00e-133 468.00
IUUC-Mla-058990 Melampsora laricipopulina 25.37 4.00e-15 74.70
IUUC-Mga-060072 Meleagris gallopavo 45.12 2.00e-60 224.00
IUUC-Mvi-060312 Microbotryum violaceum 35.08 2.00e-39 154.00
IUUC-Mmr-060851 Microcebus murinus 44.31 1.00e-59 221.00
IUUC-Mdo-063074 Monodelphis domestica 44.31 3.00e-59 223.00
IUUC-Mmu-063816 Mus musculus 45.75 1.00e-62 231.00
IUUC-Mac-065016 Musa acuminata 85.25 5.00e-95 338.00
IUUC-Mpu-066870 Mustela putorius furo 43.97 2.00e-55 207.00
IUUC-Mlu-067701 Myotis lucifugus 43.90 7.00e-59 219.00
IUUC-Nfi-068610 Neosartorya fischeri 27.65 6.00e-19 85.90
IUUC-Ncr-068780 Neurospora crassa 24.63 1.00e-18 86.30
IUUC-Nle-069291 Nomascus leucogenys 44.53 1.00e-60 224.00
IUUC-Opr-070682 Ochotona princeps 42.02 5.00e-43 167.00
IUUC-Ont-071813 Oreochromis niloticus 44.31 2.00e-60 224.00
IUUC-Oan-073031 Ornithorhynchus anatinus 43.90 2.00e-59 221.00
IUUC-Ocu-074648 Oryctolagus cuniculus 44.31 6.00e-60 223.00
IUUC-Oba-074993 Oryza barthii 78.23 7.00e-121 425.00
IUUC-Obr-076341 Oryza brachyantha 76.21 2.00e-118 417.00
IUUC-Ogl-077099 Oryza glaberrima 78.23 7.00e-121 425.00
IUUC-Ogu-078285 Oryza glumaepatula 78.63 2.00e-121 427.00
IUUC-Oin-079441 Oryza indica 78.63 2.00e-121 426.00
IUUC-Olo-081037 Oryza longistaminata 78.63 2.00e-121 426.00
IUUC-Ome-081357 Oryza meridionalis 78.63 2.00e-121 426.00
IUUC-Oni-082632 Oryza nivara 78.23 1.00e-120 424.00
IUUC-Opu-083351 Oryza punctata 77.68 1.00e-112 397.00
IUUC-Oru-084306 Oryza rufipogon 78.63 2.00e-121 426.00
IUUC-Osa-085307 Oryza sativa 78.63 2.00e-121 426.00
IUUC-Ola-086371 Oryzias latipes 44.72 8.00e-61 225.00
IUUC-Olu-087646 Ostreococcus lucimarinus 43.09 7.00e-54 202.00
IUUC-Oga-088621 Otolemur garnettii 44.72 2.00e-60 224.00
IUUC-Oar-090405 Ovis aries 44.72 3.00e-60 224.00
IUUC-Ptr-090735 Pan troglodytes 44.31 6.00e-60 223.00
IUUC-Pan-092825 Papio anubis 44.13 8.00e-61 225.00
IUUC-Psi-093110 Pelodiscus sinensis 43.53 2.00e-54 204.00
IUUC-Pma-094196 Petromyzon marinus 39.78 2.00e-41 161.00
IUUC-Pno-095145 Phaeosphaeria nodorum 30.19 1.00e-22 99.00
IUUC-Ppa-095306 Physcomitrella patens 74.60 7.00e-116 408.00
IUUC-Pfo-097121 Poecilia formosa 43.50 1.00e-60 225.00
IUUC-Pab-098197 Pongo abelii 43.10 9.00e-55 205.00
IUUC-Pop-098821 Populus trichocarpa 89.43 2.00e-64 236.00
IUUC-Pca-100218 Procavia capensis 42.68 2.00e-58 217.00
IUUC-Ppe-102032 Prunus persica 87.60 1.00e-133 467.00
IUUC-Pva-102691 Pteropus vampyrus 44.53 9.00e-61 225.00
IUUC-Pgr-103633 Puccinia graminis 27.49 7.00e-22 96.70
IUUC-Ptt-103979 Puccinia triticina 33.33 1.00e-04 39.70
IUUC-Pyt-104428 Pyrenophora triticirepentis 25.24 4.00e-20 90.50
IUUC-Rno-105016 Rattus norvegicus 46.15 1.00e-62 232.00
IUUC-Sce-106358 Saccharomyces cerevisiae 25.19 1.00e-20 92.80
IUUC-Sha-106888 Sarcophilus harrisii 44.31 6.00e-60 223.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.87 3.00e-21 94.40
IUUC-Spo-108207 Schizosaccharomyces pombe 35.91 3.00e-25 107.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 32.70 8.00e-32 129.00
IUUC-Smo-108750 Selaginella moellendorffii 68.03 7.00e-97 345.00
IUUC-Sit-110052 Setaria italica 77.29 1.00e-121 427.00
IUUC-Sly-111489 Solanum lycopersicum 82.88 4.00e-130 456.00
IUUC-Stu-112517 Solanum tuberosum 65.46 2.00e-100 357.00
IUUC-Sar-113509 Sorex araneus 44.19 8.00e-40 155.00
IUUC-Sbi-114113 Sorghum bicolor 78.23 3.00e-121 426.00
IUUC-Sre-115221 Sporisorium reilianum 26.30 6.00e-25 107.00
IUUC-Ssc-115547 Sus scrofa 44.53 1.00e-60 224.00
IUUC-Tgu-117196 Taeniopygia guttata 45.12 2.00e-60 224.00
IUUC-Tru-117740 Takifugu rubripes 45.31 4.00e-61 226.00
IUUC-Tsy-119599 Tarsius syrichta 44.31 5.00e-60 223.00
IUUC-Tni-120542 Tetraodon nigroviridis 43.31 3.00e-59 220.00
IUUC-Tca-121033 Theobroma cacao 89.96 1.00e-142 497.00
IUUC-Tre-121986 Trichoderma reesei 25.51 2.00e-20 91.70
IUUC-Tvi-122607 Trichoderma virens 31.03 5.00e-27 113.00
IUUC-Tae-125740 Triticum aestivum 66.10 6.00e-114 402.00
IUUC-Tur-126375 Triticum urartu 59.81 3.00e-109 387.00
IUUC-Tme-126878 Tuber melanosporum 31.58 6.00e-35 140.00
IUUC-Tbe-127429 Tupaia belangeri 42.02 5.00e-43 167.00
IUUC-Ttr-129086 Tursiops truncatus 40.65 2.00e-51 194.00
IUUC-Uma-129364 Ustilago maydis 27.76 8.00e-31 126.00
IUUC-Vda-129929 Verticillium dahliae 32.09 1.00e-20 93.20
IUUC-Vpa-130048 Vicugna pacos 38.21 5.00e-46 176.00
IUUC-Xtr-131888 Xenopus tropicalis 43.50 1.00e-59 222.00
IUUC-Xma-134122 Xiphophorus maculatus 43.90 3.00e-61 227.00
IUUC-Yli-134595 Yarrowia lipolytica 31.78 2.00e-33 134.00
IUUC-Zma-135642 Zea mays 76.31 6.00e-119 419.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved