• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • TRANSFAC
    • miRNAMap
    • RAID2
  • PPI
    • IID
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Sce-106233
Ensembl Protein ID YMR022W
UniProt Accession Q02159; D6VZJ6; UBC7_YEAST
Genbank Protein ID CAA47302.1; CAA48846.1; CAA89125.1; AAS56442.1; DAA09920.1
Protein Name Ubiquitin-conjugating enzyme E2 7; E2 ubiquitin-conjugating enzyme 7; Ubiquitin carrier protein; Ubiquitin-conjugating enzyme E2-18 kDa; Ubiquitin-protein ligase
Genbank Nucleotide ID X66829; X69100; Z49211; AY558116; BK006946
Gene Name UBC7; QRI8; YMR022W; YM9711.12
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
YMR022W YMR022W YMR022W
Annotation
mRNA Expression
GEOFFGED
DNA & RNA Element
TRANSFAC
Protein-protein Interaction
IIDiRefIndexHINTMentha
Protein 3D Structure
PDBMMDB
Post-translational Modifications (PTMs)
CPLMdbPTMBioGRID
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E2/UBC E2_UBC 17310239; 19520858
Classification
Family E-value Score Start End
E2/UBC 7.00e-51 170.1 8 156
Active Site
Position(s) Description Evidence
89 Glycyl thioester intermediate N/A
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilk...........eeek 91
    Rl kel++l kd+p+gi+a+p++e++++ w++li Gp+dtpY++gvF++++efp+dYP++PPk++f+ +i+hPn+y+nG+vC+sil+ ee+
   Q: 8 RLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHspgddpnmyelAEER 109
    899***********************************************************************************88999999**999*** PP
   S: 92 Wspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    Wsp++sve++lls++s+l+epn+es++n +a+ l+++nr e++++v+
   Q: 110 WSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVK 156
    ********************************************997 PP
   

Organism Saccharomyces cerevisiae
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains, and of the HRD1 ubiquitin ligase complex, which is part of the ERAD-L and ERAD-M pathways responsible for the rapid degradation of soluble lumenal and membrane proteins with misfolded lumenal domains (ERAD-L), or ER-membrane proteins with misfolded transmembrane domains (ERAD-M). Involved in resistance to cadmium poisoning.
Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains, and of the HRD1 ubiquitin ligase complex, which is part of the ERAD-L and ERAD-M pathways responsible for the rapid degradation of soluble lumenal and membrane proteins with misfolded lumenal domains (ERAD-L), or ER-membrane proteins with misfolded transmembrane domains (ERAD-M). Involved in resistance to cadmium poisoning.
Protein Sequence
(Fasta)
MSKTAQKRLL KELQQLIKDS PPGIVAGPKS ENNIFIWDCL IQGPPDTPYA DGVFNAKLEF 60
PKDYPLSPPK LTFTPSILHP NIYPNGEVCI SILHSPGDDP NMYELAEERW SPVQSVEKIL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sce-106233|E2,E2/UBC|Saccharomyces cerevisiae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCGAAAA CCGCTCAGAA ACGTCTCCTC AAGGAGCTTC AACAGTTAAT TAAAGATTCT 60
CCACCTGGTA TAGTGGCTGG TCCCAAATCG GAGAATAACA TATTCATTTG GGACTGCCTA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sce-106233|E2,E2/UBC|Saccharomyces cerevisiae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0067--ATP-binding
KW-0104--Cadmium
KW-0105--Cadmium resistance
KW-0181--Complete proteome
KW-0256--Endoplasmic reticulum
KW-0472--Membrane
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0882--Thioester bond
KW-0808--Transferase
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000837--C:Doa10p ubiquitin ligase complex
GO:0005789--C:endoplasmic reticulum membrane
GO:0000839--C:Hrd1p ubiquitin ligase ERAD-L complex
GO:0005524--F:ATP binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0004842--F:ubiquitin-protein transferase activity
GO:0006333--P:chromatin assembly or disassembly
GO:0031505--P:fungal-type cell wall organization
GO:0000209--P:protein polyubiquitination
GO:0046686--P:response to cadmium ion
GO:0030433--P:ubiquitin-dependent ERAD pathway

KEGG sce:YMR022W
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000411 Aegilops tauschii 39.20 2.00e-30 122.00
IUUC-Aml-002172 Ailuropoda melanoleuca 62.18 3.00e-52 195.00
IUUC-Atr-003150 Amborella trichopoda 59.46 3.00e-38 148.00
IUUC-Apl-003761 Anas platyrhynchos 60.37 1.00e-53 200.00
IUUC-Aca-005062 Anolis carolinensis 61.21 2.00e-54 202.00
IUUC-Aly-006282 Arabidopsis lyrata 55.71 7.00e-45 170.00
IUUC-Ath-007258 Arabidopsis thaliana 55.10 2.00e-38 149.00
IUUC-Ago-007853 Ashbya gossypii 81.82 8.00e-82 293.00
IUUC-Acl-008080 Aspergillus clavatus 61.45 1.00e-58 216.00
IUUC-Afl-008478 Aspergillus flavus 59.04 8.00e-57 210.00
IUUC-Afu-009051 Aspergillus fumigatus 61.45 1.00e-58 216.00
IUUC-Ani-009271 Aspergillus nidulans 62.76 5.00e-51 191.00
IUUC-Ang-009748 Aspergillus niger 60.24 1.00e-57 213.00
IUUC-Aor-010228 Aspergillus oryzae 59.04 1.00e-56 210.00
IUUC-Ate-010293 Aspergillus terreus 60.24 1.00e-57 213.00
IUUC-Ame-011698 Astyanax mexicanus 62.42 2.00e-57 212.00
IUUC-Bgr-012226 Blumeria graminis 57.32 2.00e-54 202.00
IUUC-Bta-013277 Bos taurus 65.85 4.00e-44 167.00
IUUC-Bci-013676 Botrytis cinerea 57.32 5.00e-55 204.00
IUUC-Bdi-014838 Brachypodium distachyon 53.25 4.00e-40 154.00
IUUC-Bol-016017 Brassica oleracea 58.57 2.00e-46 175.00
IUUC-Bra-017105 Brassica rapa 58.57 2.00e-46 175.00
IUUC-Cel-018676 Caenorhabditis elegans 57.67 2.00e-54 202.00
IUUC-Cja-019767 Callithrix jacchus 62.42 8.00e-57 210.00
IUUC-Cfa-020047 Canis familiaris 62.42 2.00e-56 209.00
IUUC-Cpo-021507 Cavia porcellus 62.42 9.00e-57 210.00
IUUC-Cre-022895 Chlamydomonas reinhardtii 53.80 3.00e-43 165.00
IUUC-Csa-023745 Chlorocebus sabaeus 61.64 1.00e-52 196.00
IUUC-Cin-025310 Ciona intestinalis 60.74 9.00e-57 210.00
IUUC-Csv-025961 Ciona savignyi 60.12 5.00e-56 207.00
IUUC-Cgl-026553 Colletotrichum gloeosporioides 59.26 6.00e-56 207.00
IUUC-Cne-026903 Cryptococcus neoformans 61.59 3.00e-51 191.00
IUUC-Cme-027321 Cyanidioschyzon merolae 52.15 7.00e-39 150.00
IUUC-Dre-027900 Danio rerio 62.42 2.00e-57 212.00
IUUC-Dno-029688 Dasypus novemcinctus 62.91 6.00e-52 194.00
IUUC-Dor-030686 Dipodomys ordii 47.97 2.00e-36 143.00
IUUC-Dse-031253 Dothistroma septosporum 59.39 2.00e-57 212.00
IUUC-Dme-031849 Drosophila melanogaster 60.61 1.00e-56 209.00
IUUC-Ete-033010 Echinops telfairi 62.42 2.00e-55 205.00
IUUC-Eca-033294 Equus caballus 62.18 1.00e-52 196.00
IUUC-Eeu-034947 Erinaceus europaeus 57.48 7.00e-33 130.00
IUUC-Fca-036442 Felis catus 63.97 2.00e-47 179.00
IUUC-Fal-037188 Ficedula albicollis 61.44 1.00e-51 193.00
IUUC-Fox-037762 Fusarium oxysporum 58.79 2.00e-57 212.00
IUUC-Fso-038181 Fusarium solani 57.58 1.00e-56 209.00
IUUC-Gmo-038663 Gadus morhua 60.00 1.00e-55 206.00
IUUC-Ggr-039808 Gaeumannomyces graminis 58.64 1.00e-55 206.00
IUUC-Gga-040355 Gallus gallus 61.82 2.00e-56 209.00
IUUC-Gac-041847 Gasterosteus aculeatus 61.82 2.00e-57 212.00
IUUC-Gma-044131 Glycine max 55.41 1.00e-33 133.00
IUUC-Ggo-045202 Gorilla gorilla 62.42 9.00e-57 210.00
IUUC-Hsa-046369 Homo sapiens 62.42 9.00e-57 210.00
IUUC-Hvu-047065 Hordeum vulgare 53.02 1.00e-38 150.00
IUUC-Itr-048349 Ictidomys tridecemlineatus 62.42 6.00e-57 211.00
IUUC-Kpa-049317 Komagataella pastoris 67.28 3.00e-65 238.00
IUUC-Lch-049596 Latimeria chalumnae 62.34 3.00e-53 198.00
IUUC-Lpe-051124 Leersia perrieri 55.00 3.00e-38 149.00
IUUC-Loc-052346 Lepisosteus oculatus 65.04 6.00e-44 167.00
IUUC-Lma-053126 Leptosphaeria maculans 62.88 5.00e-49 184.00
IUUC-Laf-054560 Loxodonta africana 60.87 3.00e-53 198.00
IUUC-Mcc-055172 Macaca mulatta 62.42 9.00e-57 210.00
IUUC-Meu-056891 Macropus eugenii 61.78 1.00e-52 196.00
IUUC-Mor-057260 Magnaporthe oryzae 58.02 1.00e-55 206.00
IUUC-Mpo-057468 Magnaporthe poae 58.02 3.00e-55 205.00
IUUC-Mtr-058406 Medicago truncatula 56.76 3.00e-41 158.00
IUUC-Mla-059084 Melampsora laricipopulina 60.00 5.00e-57 211.00
IUUC-Mga-059939 Meleagris gallopavo 60.76 1.00e-52 196.00
IUUC-Mvi-060514 Microbotryum violaceum 62.58 1.00e-58 216.00
IUUC-Mmr-061029 Microcebus murinus 60.48 2.00e-52 195.00
IUUC-Mdo-061820 Monodelphis domestica 63.03 1.00e-57 213.00
IUUC-Mmu-063123 Mus musculus 62.42 9.00e-57 210.00
IUUC-Mac-065294 Musa acuminata 53.69 3.00e-39 152.00
IUUC-Mpu-065866 Mustela putorius furo 62.91 1.00e-51 193.00
IUUC-Mlu-067220 Myotis lucifugus 62.18 2.00e-52 195.00
IUUC-Nfi-068395 Neosartorya fischeri 61.45 1.00e-58 216.00
IUUC-Ncr-068623 Neurospora crassa 60.49 2.00e-56 209.00
IUUC-Nle-070007 Nomascus leucogenys 62.42 9.00e-57 210.00
IUUC-Opr-070958 Ochotona princeps 52.70 4.00e-41 158.00
IUUC-Ont-071736 Oreochromis niloticus 61.21 2.00e-56 209.00
IUUC-Oan-073475 Ornithorhynchus anatinus 59.51 4.00e-52 194.00
IUUC-Ocu-074820 Oryctolagus cuniculus 61.84 4.00e-52 194.00
IUUC-Oba-075915 Oryza barthii 55.71 6.00e-44 167.00
IUUC-Obr-076863 Oryza brachyantha 54.29 1.00e-37 146.00
IUUC-Ogl-076981 Oryza glaberrima 55.71 6.00e-44 167.00
IUUC-Ogu-078183 Oryza glumaepatula 55.71 6.00e-44 167.00
IUUC-Oin-079755 Oryza indica 55.71 6.00e-44 167.00
IUUC-Olo-080576 Oryza longistaminata 55.71 6.00e-44 167.00
IUUC-Ome-081190 Oryza meridionalis 52.35 1.00e-41 160.00
IUUC-Oni-083010 Oryza nivara 55.71 6.00e-44 167.00
IUUC-Opu-083784 Oryza punctata 55.00 4.00e-38 148.00
IUUC-Oru-084817 Oryza rufipogon 55.71 6.00e-44 167.00
IUUC-Osa-085291 Oryza sativa 55.71 6.00e-44 167.00
IUUC-Ola-087571 Oryzias latipes 60.61 1.00e-56 209.00
IUUC-Olu-087887 Ostreococcus lucimarinus 50.62 3.00e-45 172.00
IUUC-Oga-088473 Otolemur garnettii 50.97 4.00e-42 161.00
IUUC-Oar-089706 Ovis aries 62.42 8.00e-57 210.00
IUUC-Ptr-090798 Pan troglodytes 62.42 9.00e-57 210.00
IUUC-Pan-091967 Papio anubis 62.42 9.00e-57 210.00
IUUC-Psi-093524 Pelodiscus sinensis 62.91 6.00e-52 194.00
IUUC-Pma-094602 Petromyzon marinus 62.59 2.00e-48 181.00
IUUC-Pno-094979 Phaeosphaeria nodorum 60.61 1.00e-59 219.00
IUUC-Ppa-095965 Physcomitrella patens 53.09 2.00e-47 179.00
IUUC-Pfo-097330 Poecilia formosa 61.21 1.00e-56 209.00
IUUC-Pab-098225 Pongo abelii 62.42 2.00e-56 209.00
IUUC-Pop-099881 Populus trichocarpa 57.14 1.00e-44 170.00
IUUC-Pca-101040 Procavia capensis 62.91 6.00e-52 194.00
IUUC-Ppe-101407 Prunus persica 56.76 1.00e-40 156.00
IUUC-Pva-103074 Pteropus vampyrus 53.90 6.00e-41 158.00
IUUC-Pgr-103674 Puccinia graminis 57.40 1.00e-54 203.00
IUUC-Ptt-103840 Puccinia triticina 56.80 2.00e-54 202.00
IUUC-Pte-104389 Pyrenophora teres 61.21 2.00e-59 218.00
IUUC-Pyt-104703 Pyrenophora triticirepentis 61.82 8.00e-60 220.00
IUUC-Rno-105228 Rattus norvegicus 62.42 9.00e-57 210.00
IUUC-Sha-107274 Sarcophilus harrisii 60.61 4.00e-53 197.00
IUUC-Sja-107937 Schizosaccharomyces japonicus 62.05 1.00e-59 220.00
IUUC-Spo-108269 Schizosaccharomyces pombe 61.45 3.00e-59 218.00
IUUC-Ssl-108636 Sclerotinia sclerotiorum 57.93 2.00e-55 205.00
IUUC-Smo-109401 Selaginella moellendorffii 58.21 1.00e-35 139.00
IUUC-Sit-110784 Setaria italica 55.71 1.00e-38 150.00
IUUC-Sly-111177 Solanum lycopersicum 57.86 5.00e-41 157.00
IUUC-Stu-112598 Solanum tuberosum 57.86 5.00e-41 157.00
IUUC-Sbi-113787 Sorghum bicolor 52.15 7.00e-41 157.00
IUUC-Sre-114952 Sporisorium reilianum 56.29 5.00e-52 194.00
IUUC-Ssc-115365 Sus scrofa 61.69 3.00e-52 195.00
IUUC-Tgu-116816 Taeniopygia guttata 61.82 2.00e-56 209.00
IUUC-Tru-118443 Takifugu rubripes 51.30 7.00e-43 164.00
IUUC-Tsy-119168 Tarsius syrichta 53.90 9.00e-41 157.00
IUUC-Tni-120278 Tetraodon nigroviridis 59.64 5.00e-54 201.00
IUUC-Tca-121649 Theobroma cacao 53.09 4.00e-40 154.00
IUUC-Tre-122131 Trichoderma reesei 59.26 2.00e-57 212.00
IUUC-Tvi-122669 Trichoderma virens 58.64 3.00e-56 208.00
IUUC-Tae-123772 Triticum aestivum 54.55 3.00e-41 159.00
IUUC-Tur-126873 Triticum urartu 53.95 2.00e-40 157.00
IUUC-Tme-127052 Tuber melanosporum 64.81 2.00e-62 228.00
IUUC-Tbe-127792 Tupaia belangeri 62.42 9.00e-57 210.00
IUUC-Ttr-128609 Tursiops truncatus 53.90 6.00e-41 158.00
IUUC-Uma-129587 Ustilago maydis 56.89 1.00e-52 196.00
IUUC-Vda-129914 Verticillium dahliae 57.41 3.00e-55 205.00
IUUC-Vpa-130208 Vicugna pacos 52.70 3.00e-41 159.00
IUUC-Vvi-131387 Vitis vinifera 57.43 3.00e-40 155.00
IUUC-Xtr-132450 Xenopus tropicalis 61.21 2.00e-56 209.00
IUUC-Xma-133016 Xiphophorus maculatus 61.21 1.00e-56 209.00
IUUC-Yli-134379 Yarrowia lipolytica 64.20 2.00e-61 225.00
IUUC-Zma-135764 Zea mays 53.02 1.00e-38 150.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved