• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • TRANSFAC
  • PPI
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Pno-095035
Ensembl Protein ID SNOT_01275
UniProt Accession Q0V3Y9; ATG8_PHANO
Genbank Protein ID EAT90924.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier ATG8
Genbank Nucleotide ID CH445326
Gene Name ATG8; SNOG_01275
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
SNOG_01275 SNOT_01275 SNOT_01275
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 7.30e-48 160.4 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayas 99
    krk+e+e+ir+k++d+iPvi+ek +k++i+++dkkkylvP+dltvgq+v++irkr++l +e+a+f++v+++l++++a +++iyee+kdedgfly++y++
   Q: 13 KRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSG 111
    699************************************************************************************************ PP
   S: 100 eetfG 104
    e+tfG
   Q: 112 ENTFG 116
    ****9 PP
   

Organism Phaeosphaeria nodorum
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MRSKFKDEHP FEKRKAEAER IRQKYNDRIP VICEKVEKSD IATIDKKKYL VPADLTVGQF 60
VYVIRKRIKL SPEKAIFIFV DEVLPPTAAL MSSIYEEHKD EDGFLYITYS GENTFGEAI 119
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pno-095035|ULD,ATG8|Phaeosphaeria nodorum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTCACCGCCG CCAGCCCTCA TTCCTACATA TCTCTCCGCC ACGCACCACA AGCACATTTC 60
ACAGACTTCT GCACCCGCTA CCACCGCACT CAACAACAGA ACCAGATCTA CTACAGTCAT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pno-095035|ULD,ATG8|Phaeosphaeria nodorum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0015031--P:protein transport

KEGG pno:SNOG_01275
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 76.92 6.00e-52 193.00
IUUC-Aml-001323 Ailuropoda melanoleuca 59.48 3.00e-39 151.00
IUUC-Atr-002791 Amborella trichopoda 82.61 1.00e-52 196.00
IUUC-Apl-003994 Anas platyrhynchos 55.17 2.00e-37 145.00
IUUC-Aca-005288 Anolis carolinensis 58.62 6.00e-39 150.00
IUUC-Aly-005554 Arabidopsis lyrata 83.48 1.00e-45 172.00
IUUC-Ath-006958 Arabidopsis thaliana 82.61 5.00e-45 170.00
IUUC-Ago-007898 Ashbya gossypii 72.81 1.00e-48 182.00
IUUC-Acl-008314 Aspergillus clavatus 97.46 5.00e-64 233.00
IUUC-Afl-008708 Aspergillus flavus 98.29 3.00e-64 234.00
IUUC-Afu-009097 Aspergillus fumigatus 97.46 5.00e-64 233.00
IUUC-Ani-009196 Aspergillus nidulans 96.61 2.00e-63 231.00
IUUC-Ang-009530 Aspergillus niger 97.46 5.00e-64 233.00
IUUC-Aor-009909 Aspergillus oryzae 98.29 3.00e-64 234.00
IUUC-Ate-010358 Aspergillus terreus 97.46 5.00e-64 233.00
IUUC-Ame-010914 Astyanax mexicanus 59.83 6.00e-40 153.00
IUUC-Bgr-012248 Blumeria graminis 95.76 5.00e-63 230.00
IUUC-Bta-012805 Bos taurus 59.48 3.00e-39 151.00
IUUC-Bci-013959 Botrytis cinerea 97.48 1.00e-65 239.00
IUUC-Bdi-014390 Brachypodium distachyon 82.61 2.00e-52 195.00
IUUC-Bol-016488 Brassica oleracea 82.05 5.00e-53 197.00
IUUC-Bra-016921 Brassica rapa 81.58 9.00e-53 196.00
IUUC-Cel-018200 Caenorhabditis elegans 56.90 8.00e-37 143.00
IUUC-Cja-019369 Callithrix jacchus 59.48 3.00e-39 151.00
IUUC-Cfa-020603 Canis familiaris 59.48 3.00e-39 151.00
IUUC-Cpo-021831 Cavia porcellus 58.62 6.00e-39 150.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 83.33 8.00e-46 173.00
IUUC-Csa-024117 Chlorocebus sabaeus 59.48 3.00e-39 151.00
IUUC-Cho-025008 Choloepus hoffmanni 51.28 7.00e-35 136.00
IUUC-Cin-025297 Ciona intestinalis 57.76 5.00e-39 150.00
IUUC-Csv-026146 Ciona savignyi 37.61 4.00e-21 91.30
IUUC-Cgl-026691 Colletotrichum gloeosporioides 71.88 1.00e-57 213.00
IUUC-Cne-026889 Cryptococcus neoformans 88.03 4.00e-59 217.00
IUUC-Dre-028351 Danio rerio 59.83 5.00e-40 154.00
IUUC-Dno-029331 Dasypus novemcinctus 58.62 6.00e-39 150.00
IUUC-Dor-030245 Dipodomys ordii 59.48 3.00e-39 151.00
IUUC-Dse-031428 Dothistroma septosporum 99.15 4.00e-65 237.00
IUUC-Dme-031813 Drosophila melanogaster 61.02 4.00e-41 157.00
IUUC-Ete-032671 Echinops telfairi 59.48 2.00e-39 152.00
IUUC-Eca-034113 Equus caballus 58.62 1.00e-38 150.00
IUUC-Eeu-035131 Erinaceus europaeus 58.14 1.00e-26 108.00
IUUC-Fca-036493 Felis catus 59.48 4.00e-39 151.00
IUUC-Fal-036896 Ficedula albicollis 58.62 9.00e-39 150.00
IUUC-Fox-037846 Fusarium oxysporum 98.31 6.00e-65 236.00
IUUC-Fso-038134 Fusarium solani 98.31 1.00e-64 235.00
IUUC-Gmo-039671 Gadus morhua 59.32 4.00e-40 154.00
IUUC-Ggr-039770 Gaeumannomyces graminis 94.87 9.00e-62 226.00
IUUC-Gga-040257 Gallus gallus 59.48 2.00e-39 152.00
IUUC-Gac-041604 Gasterosteus aculeatus 59.48 5.00e-40 154.00
IUUC-Gma-044021 Glycine max 80.00 1.00e-52 195.00
IUUC-Ggo-044860 Gorilla gorilla 59.48 4.00e-39 151.00
IUUC-Hsa-045905 Homo sapiens 59.48 3.00e-39 151.00
IUUC-Hvu-047588 Hordeum vulgare 80.87 8.00e-52 193.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 59.48 3.00e-39 151.00
IUUC-Kpa-049124 Komagataella pastoris 82.05 7.00e-55 203.00
IUUC-Lch-049542 Latimeria chalumnae 57.76 7.00e-39 150.00
IUUC-Lpe-051292 Leersia perrieri 82.61 8.00e-53 196.00
IUUC-Loc-052290 Lepisosteus oculatus 57.98 1.00e-39 153.00
IUUC-Laf-054203 Loxodonta africana 59.48 3.00e-39 151.00
IUUC-Mcc-055307 Macaca mulatta 59.48 3.00e-39 151.00
IUUC-Meu-056515 Macropus eugenii 58.62 6.00e-39 150.00
IUUC-Mor-057276 Magnaporthe oryzae 94.87 6.00e-62 226.00
IUUC-Mpo-057469 Magnaporthe poae 92.44 5.00e-61 224.00
IUUC-Mtr-057664 Medicago truncatula 77.97 2.00e-46 175.00
IUUC-Mla-059098 Melampsora laricipopulina 91.38 1.00e-60 223.00
IUUC-Mga-060108 Meleagris gallopavo 53.78 3.00e-37 145.00
IUUC-Mvi-060496 Microbotryum violaceum 91.30 8.00e-59 216.00
IUUC-Mmr-061776 Microcebus murinus 59.48 3.00e-39 151.00
IUUC-Mdo-061915 Monodelphis domestica 58.62 6.00e-39 150.00
IUUC-Mmu-064157 Mus musculus 59.48 3.00e-39 151.00
IUUC-Mac-064739 Musa acuminata 80.00 6.00e-45 170.00
IUUC-Mpu-066028 Mustela putorius furo 59.48 6.00e-39 150.00
IUUC-Mlu-067166 Myotis lucifugus 59.48 3.00e-39 151.00
IUUC-Nfi-068367 Neosartorya fischeri 97.46 5.00e-64 233.00
IUUC-Ncr-068894 Neurospora crassa 98.29 2.00e-64 235.00
IUUC-Nle-069220 Nomascus leucogenys 59.48 3.00e-39 151.00
IUUC-Opr-070777 Ochotona princeps 59.48 3.00e-39 151.00
IUUC-Ont-072343 Oreochromis niloticus 58.62 9.00e-39 149.00
IUUC-Oan-073485 Ornithorhynchus anatinus 60.95 8.00e-36 140.00
IUUC-Ocu-074148 Oryctolagus cuniculus 59.48 3.00e-39 151.00
IUUC-Oba-075722 Oryza barthii 80.00 4.00e-52 194.00
IUUC-Obr-076830 Oryza brachyantha 81.74 6.00e-53 197.00
IUUC-Ogl-077551 Oryza glaberrima 80.00 4.00e-52 194.00
IUUC-Ogu-078499 Oryza glumaepatula 80.00 4.00e-52 194.00
IUUC-Oin-079330 Oryza indica 76.92 4.00e-52 194.00
IUUC-Olo-080412 Oryza longistaminata 81.74 5.00e-52 193.00
IUUC-Ome-082013 Oryza meridionalis 76.92 4.00e-52 194.00
IUUC-Oni-082811 Oryza nivara 76.92 4.00e-52 194.00
IUUC-Opu-083501 Oryza punctata 81.74 6.00e-53 196.00
IUUC-Oru-084197 Oryza rufipogon 76.92 4.00e-52 194.00
IUUC-Osa-085654 Oryza sativa 76.92 4.00e-52 194.00
IUUC-Ola-086310 Oryzias latipes 57.76 3.00e-38 148.00
IUUC-Olu-087892 Ostreococcus lucimarinus 82.14 3.00e-53 198.00
IUUC-Oga-088312 Otolemur garnettii 59.48 3.00e-39 151.00
IUUC-Oar-089989 Ovis aries 59.48 3.00e-39 151.00
IUUC-Ptr-091108 Pan troglodytes 59.48 3.00e-39 151.00
IUUC-Pan-092269 Papio anubis 58.62 6.00e-39 150.00
IUUC-Psi-093055 Pelodiscus sinensis 54.70 2.00e-37 145.00
IUUC-Pma-094337 Petromyzon marinus 57.76 2.00e-40 155.00
IUUC-Ppa-095701 Physcomitrella patens 82.20 2.00e-47 179.00
IUUC-Pfo-096380 Poecilia formosa 57.76 1.00e-38 149.00
IUUC-Pab-097660 Pongo abelii 59.48 3.00e-39 151.00
IUUC-Pop-099701 Populus trichocarpa 81.36 6.00e-45 170.00
IUUC-Pca-100230 Procavia capensis 59.48 3.00e-39 151.00
IUUC-Ppe-101670 Prunus persica 80.00 2.00e-45 171.00
IUUC-Pva-103103 Pteropus vampyrus 54.70 2.00e-37 145.00
IUUC-Pte-104230 Pyrenophora teres 99.16 3.00e-66 241.00
IUUC-Rno-105497 Rattus norvegicus 59.48 3.00e-39 151.00
IUUC-Sce-106150 Saccharomyces cerevisiae 79.31 1.00e-52 196.00
IUUC-Sha-106656 Sarcophilus harrisii 59.48 3.00e-39 151.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 86.55 3.00e-58 214.00
IUUC-Spo-108156 Schizosaccharomyces pombe 86.21 6.00e-49 183.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 96.64 5.00e-65 237.00
IUUC-Smo-109082 Selaginella moellendorffii 78.81 6.00e-52 193.00
IUUC-Sit-110531 Setaria italica 81.58 2.00e-51 192.00
IUUC-Sly-111700 Solanum lycopersicum 81.90 2.00e-52 194.00
IUUC-Stu-112612 Solanum tuberosum 81.03 2.00e-52 195.00
IUUC-Sar-113670 Sorex araneus 54.31 8.00e-35 136.00
IUUC-Sbi-114346 Sorghum bicolor 81.74 5.00e-52 194.00
IUUC-Sre-114964 Sporisorium reilianum 86.44 1.00e-57 212.00
IUUC-Ssc-116182 Sus scrofa 59.48 3.00e-39 151.00
IUUC-Tgu-117195 Taeniopygia guttata 58.62 7.00e-39 150.00
IUUC-Tru-118632 Takifugu rubripes 58.47 1.00e-39 153.00
IUUC-Tsy-118919 Tarsius syrichta 54.70 2.00e-37 145.00
IUUC-Tni-120706 Tetraodon nigroviridis 57.76 2.00e-38 148.00
IUUC-Tca-121335 Theobroma cacao 77.97 2.00e-46 176.00
IUUC-Tre-122077 Trichoderma reesei 98.31 9.00e-65 236.00
IUUC-Tvi-122400 Trichoderma virens 98.31 9.00e-65 236.00
IUUC-Tae-122697 Triticum aestivum 76.92 2.00e-51 193.00
IUUC-Tur-126158 Triticum urartu 76.07 3.00e-51 191.00
IUUC-Tme-126955 Tuber melanosporum 98.28 1.00e-62 230.00
IUUC-Tbe-127765 Tupaia belangeri 62.79 5.00e-30 120.00
IUUC-Ttr-128205 Tursiops truncatus 58.62 6.00e-39 150.00
IUUC-Uma-129435 Ustilago maydis 86.32 1.00e-57 212.00
IUUC-Vda-129807 Verticillium dahliae 97.46 2.00e-64 235.00
IUUC-Vpa-130804 Vicugna pacos 57.76 2.00e-38 149.00
IUUC-Vvi-130830 Vitis vinifera 82.61 5.00e-46 174.00
IUUC-Xtr-132685 Xenopus tropicalis 58.62 4.00e-39 150.00
IUUC-Xma-133400 Xiphophorus maculatus 58.47 1.00e-39 152.00
IUUC-Yli-134327 Yarrowia lipolytica 90.60 1.00e-52 196.00
IUUC-Zma-135270 Zea mays 82.61 1.00e-52 196.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved