• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • TRANSFAC
  • PPI
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Mmu-063694
UUCD1 version UUC-MuM-00071
Ensembl Protein ID ENSMUSP00000038744.5
UniProt Accession Q9WTX5; Q8C5H6; SKP1_MOUSE
Genbank Protein ID AAD16036.1; BAB22496.1; BAB27074.1; BAB28281.1; BAB29222.1; BAC25660.1; BAC37220.1; BAC40292.1; AAH02115.1
Protein Name S-phase kinase-associated protein 1; Cyclin-A/CDK2-associated protein p19; S-phase kinase-associated protein 1A; p19A; p19skp1
Genbank Nucleotide ID AF083214; AK002983; AK010628; AK012498; AK014245; AK027909; AK078330; AK088339; BC002115
Gene Name Skp1; Skp1a
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMUSG00000036309.14 ENSMUST00000147684.7 ENSMUSP00000129711.1
ENSMUSG00000036309.14 ENSMUST00000037324.11 ENSMUSP00000038744.5
ENSMUSG00000036309.14 ENSMUST00000166537.7 ENSMUSP00000131833.1
ENSMUSG00000036309.14 ENSMUST00000116595.2 ENSMUSP00000112294.2
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpressGXD
DNA & RNA Element
AREsitemiRTarBasemicroRNATRANSFAC
RepTarRAID2
Protein-protein Interaction
IIDiRefIndexPINAHINT
Mentha
Post-translational Modifications (PTMs)
CPLMdbPAFPhosphositePlusdbPTM
UniProtPHOSIDAmUbiSiDa
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/SCF/SKP1 SKP1 20082978
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 1.90e-31 109.1 113 160
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd+tcktVa+mikgktpeeiRktFni+nDft+eEea+vR+EnqW+
   Q: 113 KGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC 160
    89*********************************************9 PP
   

Organism Mus musculus
Functional Description
(View)

Functional Description



     Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2 (By similarity).
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2 (By similarity).
Protein Sequence
(Fasta)
MPTIKLQSSD GEIFEVDVEI AKQSVTIKTM LEDLGMDDEG DDDPVPLPNV NAAILKKVIQ 60
WCTHHKDDPP PPEDDENKEK RTDDIPVWDQ EFLKVDQGTL FELILAANYL DIKGLLDVTC 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mmu-063694|E3,SKP1|Mus musculus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GCGTCCCGCT GCTATAAAAG GCGACGCCGC GCGGCGCCGC TCGAGTGGCC TTGTTCTCGA 60
TACTTCGTTG TGGTTGTGAA CTCTGTCCGG CAGCCTCGGG CCTGCGGTCT TGAGACGGAG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mmu-063694|E3,SKP1|Mus musculus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1017--Isopeptide bond
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0005813--C:centrosome
GO:0031467--C:Cul7-RING ubiquitin ligase complex
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0070062--C:extracellular exosome
GO:0005634--C:nucleus
GO:0019005--C:SCF ubiquitin ligase complex
GO:0008013--F:beta-catenin binding
GO:0097602--F:cullin family protein binding
GO:0004842--F:ubiquitin-protein transferase activity
GO:0035518--P:histone H2A monoubiquitination
GO:0051457--P:maintenance of protein location in nucleus
GO:0016567--P:protein ubiquitination
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG mmu:21402
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 58.49 8.00e-48 182.00
IUUC-Aml-002023 Ailuropoda melanoleuca 99.39 6.00e-72 262.00
IUUC-Atr-002858 Amborella trichopoda 59.75 3.00e-36 144.00
IUUC-Apl-003393 Anas platyrhynchos 99.39 6.00e-72 262.00
IUUC-Aca-004709 Anolis carolinensis 99.39 6.00e-72 262.00
IUUC-Aly-006236 Arabidopsis lyrata 54.04 4.00e-43 166.00
IUUC-Ath-006881 Arabidopsis thaliana 55.29 8.00e-42 162.00
IUUC-Ago-007847 Ashbya gossypii 47.16 2.00e-37 148.00
IUUC-Acl-008178 Aspergillus clavatus 64.38 2.00e-52 198.00
IUUC-Afl-008452 Aspergillus flavus 63.58 4.00e-53 200.00
IUUC-Afu-008785 Aspergillus fumigatus 64.20 1.00e-53 201.00
IUUC-Ani-009312 Aspergillus nidulans 58.86 3.00e-48 184.00
IUUC-Aor-010012 Aspergillus oryzae 63.58 4.00e-53 200.00
IUUC-Ate-010375 Aspergillus terreus 64.60 2.00e-53 201.00
IUUC-Ame-011025 Astyanax mexicanus 99.39 6.00e-72 262.00
IUUC-Bgr-012280 Blumeria graminis 60.42 2.00e-38 151.00
IUUC-Bta-013519 Bos taurus 99.39 6.00e-72 262.00
IUUC-Bci-013888 Botrytis cinerea 60.69 6.00e-35 139.00
IUUC-Bdi-014547 Brachypodium distachyon 57.86 1.00e-37 149.00
IUUC-Bol-016431 Brassica oleracea 57.50 4.00e-40 156.00
IUUC-Bra-017558 Brassica rapa 56.17 5.00e-42 163.00
IUUC-Cel-018653 Caenorhabditis elegans 70.81 5.00e-54 203.00
IUUC-Cja-019785 Callithrix jacchus 96.25 2.00e-65 241.00
IUUC-Cfa-020931 Canis familiaris 98.77 5.00e-71 259.00
IUUC-Cpo-022487 Cavia porcellus 98.77 1.00e-69 255.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 59.24 2.00e-43 167.00
IUUC-Csa-023459 Chlorocebus sabaeus 98.77 1.00e-71 261.00
IUUC-Cho-024854 Choloepus hoffmanni 63.85 3.00e-30 123.00
IUUC-Cin-025538 Ciona intestinalis 90.18 6.00e-66 242.00
IUUC-Csv-025865 Ciona savignyi 90.18 3.00e-69 253.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 61.11 4.00e-43 167.00
IUUC-Cne-027058 Cryptococcus neoformans 56.10 6.00e-46 176.00
IUUC-Cme-027174 Cyanidioschyzon merolae 48.10 1.00e-37 149.00
IUUC-Dre-027756 Danio rerio 99.39 6.00e-72 262.00
IUUC-Dno-028924 Dasypus novemcinctus 99.39 6.00e-72 262.00
IUUC-Dor-030847 Dipodomys ordii 91.36 2.00e-66 244.00
IUUC-Dse-031209 Dothistroma septosporum 59.88 4.00e-48 183.00
IUUC-Dme-032028 Drosophila melanogaster 76.07 7.00e-62 229.00
IUUC-Ete-033117 Echinops telfairi 94.48 2.00e-67 247.00
IUUC-Eca-033320 Equus caballus 99.39 6.00e-72 262.00
IUUC-Eeu-034817 Erinaceus europaeus 97.87 1.00e-22 97.10
IUUC-Fca-035423 Felis catus 99.39 6.00e-72 262.00
IUUC-Fal-036956 Ficedula albicollis 99.39 6.00e-72 262.00
IUUC-Fox-037761 Fusarium oxysporum 59.86 4.00e-43 166.00
IUUC-Fso-038451 Fusarium solani 59.86 2.00e-42 164.00
IUUC-Gmo-039178 Gadus morhua 100.00 3.00e-72 263.00
IUUC-Ggr-039831 Gaeumannomyces graminis 58.33 3.00e-41 160.00
IUUC-Gga-040238 Gallus gallus 99.39 6.00e-72 262.00
IUUC-Gac-041965 Gasterosteus aculeatus 100.00 3.00e-72 263.00
IUUC-Gma-043086 Glycine max 59.01 3.00e-42 163.00
IUUC-Ggo-045025 Gorilla gorilla 99.39 6.00e-72 262.00
IUUC-Hsa-046875 Homo sapiens 99.39 6.00e-72 262.00
IUUC-Hvu-047497 Hordeum vulgare 55.56 4.00e-40 157.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 96.93 5.00e-70 256.00
IUUC-Kpa-049138 Komagataella pastoris 46.15 1.00e-37 149.00
IUUC-Lch-050522 Latimeria chalumnae 98.72 2.00e-77 281.00
IUUC-Lpe-051398 Leersia perrieri 53.61 8.00e-42 163.00
IUUC-Loc-052596 Lepisosteus oculatus 100.00 3.00e-72 263.00
IUUC-Lma-053020 Leptosphaeria maculans 58.33 3.00e-40 157.00
IUUC-Laf-053847 Loxodonta africana 99.39 6.00e-72 262.00
IUUC-Mor-057176 Magnaporthe oryzae 57.64 5.00e-41 160.00
IUUC-Mpo-057471 Magnaporthe poae 58.33 2.00e-41 160.00
IUUC-Mtr-058258 Medicago truncatula 58.49 2.00e-41 161.00
IUUC-Mla-059153 Melampsora laricipopulina 60.87 7.00e-48 182.00
IUUC-Mga-059864 Meleagris gallopavo 99.39 6.00e-72 262.00
IUUC-Mvi-060342 Microbotryum violaceum 59.63 3.00e-48 183.00
IUUC-Mdo-062509 Monodelphis domestica 99.39 6.00e-72 262.00
IUUC-Mac-064537 Musa acuminata 59.01 1.00e-38 152.00
IUUC-Mpu-065990 Mustela putorius furo 99.39 6.00e-72 262.00
IUUC-Mlu-068168 Myotis lucifugus 99.39 6.00e-72 262.00
IUUC-Nfi-068309 Neosartorya fischeri 64.20 1.00e-53 201.00
IUUC-Ncr-068658 Neurospora crassa 59.72 1.00e-42 165.00
IUUC-Nle-070101 Nomascus leucogenys 99.39 6.00e-72 262.00
IUUC-Opr-070881 Ochotona princeps 99.39 6.00e-72 262.00
IUUC-Ont-071529 Oreochromis niloticus 100.00 3.00e-72 263.00
IUUC-Oan-072985 Ornithorhynchus anatinus 98.11 6.00e-37 145.00
IUUC-Ocu-073780 Oryctolagus cuniculus 99.39 6.00e-72 262.00
IUUC-Oba-075368 Oryza barthii 52.35 1.00e-39 155.00
IUUC-Obr-076218 Oryza brachyantha 56.44 5.00e-39 154.00
IUUC-Ogl-077679 Oryza glaberrima 52.35 1.00e-39 155.00
IUUC-Ogu-078125 Oryza glumaepatula 54.71 2.00e-39 154.00
IUUC-Oin-079779 Oryza indica 52.35 2.00e-39 155.00
IUUC-Olo-080795 Oryza longistaminata 44.72 2.00e-26 111.00
IUUC-Ome-081330 Oryza meridionalis 55.03 2.00e-39 155.00
IUUC-Oni-082143 Oryza nivara 52.35 2.00e-39 155.00
IUUC-Opu-083354 Oryza punctata 53.85 3.00e-36 144.00
IUUC-Oru-085023 Oryza rufipogon 56.60 6.00e-37 146.00
IUUC-Osa-085416 Oryza sativa 52.35 2.00e-39 155.00
IUUC-Ola-087270 Oryzias latipes 100.00 3.00e-72 263.00
IUUC-Olu-087667 Ostreococcus lucimarinus 58.86 7.00e-47 179.00
IUUC-Oga-089073 Otolemur garnettii 99.39 6.00e-72 262.00
IUUC-Oar-089762 Ovis aries 80.98 1.00e-60 225.00
IUUC-Ptr-090872 Pan troglodytes 90.18 6.00e-67 246.00
IUUC-Pan-091780 Papio anubis 99.39 6.00e-72 262.00
IUUC-Psi-093135 Pelodiscus sinensis 99.39 6.00e-72 262.00
IUUC-Pno-094810 Phaeosphaeria nodorum 56.25 5.00e-38 150.00
IUUC-Ppa-095244 Physcomitrella patens 59.12 1.00e-42 165.00
IUUC-Pfo-097529 Poecilia formosa 100.00 3.00e-72 263.00
IUUC-Pab-098533 Pongo abelii 99.39 6.00e-72 262.00
IUUC-Pop-098957 Populus trichocarpa 59.24 7.00e-42 162.00
IUUC-Pca-100783 Procavia capensis 88.34 2.00e-59 221.00
IUUC-Ppe-101410 Prunus persica 56.79 1.00e-45 175.00
IUUC-Pva-102901 Pteropus vampyrus 99.39 6.00e-72 262.00
IUUC-Pgr-103499 Puccinia graminis 59.63 5.00e-48 183.00
IUUC-Ptt-103874 Puccinia triticina 62.96 2.00e-41 162.00
IUUC-Pte-104224 Pyrenophora teres 56.25 3.00e-33 134.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 55.86 5.00e-34 137.00
IUUC-Rno-105499 Rattus norvegicus 100.00 3.00e-72 263.00
IUUC-Sce-106387 Saccharomyces cerevisiae 43.16 1.00e-36 145.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 56.36 2.00e-47 181.00
IUUC-Spo-108033 Schizosaccharomyces pombe 56.36 7.00e-47 179.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 62.07 9.00e-42 162.00
IUUC-Smo-109307 Selaginella moellendorffii 56.55 4.00e-43 167.00
IUUC-Sit-110435 Setaria italica 55.09 1.00e-38 152.00
IUUC-Sly-111627 Solanum lycopersicum 58.02 1.00e-40 158.00
IUUC-Stu-112611 Solanum tuberosum 58.02 1.00e-40 158.00
IUUC-Sar-112973 Sorex araneus 90.18 8.00e-62 229.00
IUUC-Sbi-114394 Sorghum bicolor 56.10 2.00e-41 161.00
IUUC-Sre-115178 Sporisorium reilianum 61.49 3.00e-50 190.00
IUUC-Tgu-116474 Taeniopygia guttata 99.39 6.00e-72 262.00
IUUC-Tru-118429 Takifugu rubripes 99.39 3.00e-72 263.00
IUUC-Tsy-118896 Tarsius syrichta 99.39 6.00e-72 262.00
IUUC-Tni-119960 Tetraodon nigroviridis 99.39 3.00e-72 263.00
IUUC-Tca-121022 Theobroma cacao 59.63 4.00e-42 163.00
IUUC-Tre-122004 Trichoderma reesei 57.64 2.00e-35 141.00
IUUC-Tvi-122449 Trichoderma virens 57.64 7.00e-36 142.00
IUUC-Tae-125854 Triticum aestivum 58.49 8.00e-48 182.00
IUUC-Tur-126200 Triticum urartu 55.56 2.00e-45 174.00
IUUC-Tme-127078 Tuber melanosporum 57.93 4.00e-45 173.00
IUUC-Tbe-127720 Tupaia belangeri 99.39 6.00e-72 262.00
IUUC-Ttr-129035 Tursiops truncatus 99.39 6.00e-72 262.00
IUUC-Uma-129517 Ustilago maydis 59.01 3.00e-47 180.00
IUUC-Vda-129691 Verticillium dahliae 57.14 7.00e-42 162.00
IUUC-Vpa-130128 Vicugna pacos 99.39 8.00e-72 262.00
IUUC-Vvi-130876 Vitis vinifera 58.75 1.00e-45 175.00
IUUC-Xtr-132393 Xenopus tropicalis 99.39 6.00e-72 262.00
IUUC-Xma-133603 Xiphophorus maculatus 100.00 3.00e-72 263.00
IUUC-Yli-134499 Yarrowia lipolytica 55.15 4.00e-46 176.00
IUUC-Zma-134722 Zea mays 46.78 3.00e-35 141.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved