• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Ani-009196
Ensembl Protein ID CADANIAP00003115
UniProt Accession Q5B2U9; C8VEZ3; ATG8_EMENI
Genbank Protein ID EAA62312.1; CBF80918.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier atg8
Genbank Nucleotide ID AACD01000088; BN001305
Gene Name ANIA_05131; atg8; AN5131
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CADANIAG00003115 CADANIAT00003115 CADANIAP00003115
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 1.00e-47 159.7 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8
   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgfl 93
           krk+e+e+ir+k+ d+iPvi+ek +k++i+++dkkkylvP+dltvgq+v++irkr++l +e+a+f++v+++l++++a +++iyee+kdedgfl
   Q: 13   KRKAEAERIRAKYADRIPVICEKVEKSDIATIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFL 105
           699****************************************************************************************** PP
   S: 94   yvayaseetfG 104
           y++y++e+tfG
   Q: 106  YITYSGENTFG 116
           **********9 PP
   
Organism Aspergillus nidulans
Functional Description
(View)

Functional Description


     Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
 Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MRSKFKDEHP FEKRKAEAER IRAKYADRIP VICEKVEKSD IATIDKKKYL VPADLTVGQF 60
VYVIRKRIKL SPEKAIFIFV DEVLPPTAAL MSSIYEEHKD EDGFLYITYS GENTFGDC 118
It may take some time, please wait.

Protein Fasta Sequence


>IUUC-Ani-009196|ULD,ATG8|Aspergillus nidulans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCGTTCCA AGTTTAAGGA CGAGCACCCG TTCGAGAAGC GCAAGGCTGA AGCCGAGCGT 60
ATTAGAGCGA AATATGCCGA CCGGATTCCG GTATGTTTTT TCTTTCGTTA TGTGTTTGAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence


>IUUC-Ani-009196|ULD,ATG8|Aspergillus nidulans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole
Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom
Pfam

PF02991--Atg8
Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0034045--C:pre-autophagosomal structure membrane
GO:0006914--P:autophagy
GO:0015031--P:protein transport
KEGG ani:AN5131.2
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 78.95 1.00e-51 192.00
IUUC-Aml-001629 Ailuropoda melanoleuca 59.48 1.00e-39 152.00
IUUC-Atr-002791 Amborella trichopoda 82.61 3.00e-52 194.00
IUUC-Apl-003994 Anas platyrhynchos 55.17 2.00e-37 145.00
IUUC-Aca-005288 Anolis carolinensis 59.48 1.00e-39 152.00
IUUC-Aly-005554 Arabidopsis lyrata 83.48 1.00e-45 172.00
IUUC-Ath-006958 Arabidopsis thaliana 82.61 4.00e-45 171.00
IUUC-Ago-007898 Ashbya gossypii 72.81 2.00e-48 182.00
IUUC-Acl-008314 Aspergillus clavatus 99.15 3.00e-65 238.00
IUUC-Afl-008708 Aspergillus flavus 98.31 3.00e-64 234.00
IUUC-Afu-009097 Aspergillus fumigatus 99.15 3.00e-65 238.00
IUUC-Ang-009530 Aspergillus niger 99.15 3.00e-65 238.00
IUUC-Aor-009909 Aspergillus oryzae 98.31 3.00e-64 234.00
IUUC-Ate-010358 Aspergillus terreus 99.15 3.00e-65 238.00
IUUC-Ame-010914 Astyanax mexicanus 58.97 2.00e-39 152.00
IUUC-Bgr-012248 Blumeria graminis 97.46 4.00e-64 234.00
IUUC-Bta-012520 Bos taurus 59.48 2.00e-39 152.00
IUUC-Bci-013959 Botrytis cinerea 94.92 8.00e-63 229.00
IUUC-Bdi-014390 Brachypodium distachyon 82.61 4.00e-52 194.00
IUUC-Bol-016488 Brassica oleracea 82.61 2.00e-52 195.00
IUUC-Bra-016921 Brassica rapa 81.58 1.00e-52 196.00
IUUC-Cel-018200 Caenorhabditis elegans 56.90 7.00e-37 143.00
IUUC-Cja-019369 Callithrix jacchus 59.48 4.00e-39 151.00
IUUC-Cfa-020373 Canis familiaris 59.48 2.00e-39 152.00
IUUC-Cpo-021831 Cavia porcellus 59.48 2.00e-39 152.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 84.82 7.00e-46 174.00
IUUC-Csa-024201 Chlorocebus sabaeus 59.48 2.00e-39 152.00
IUUC-Cho-025008 Choloepus hoffmanni 51.72 8.00e-35 136.00
IUUC-Cin-025297 Ciona intestinalis 57.76 5.00e-39 150.00
IUUC-Csv-026146 Ciona savignyi 37.61 6.00e-21 90.90
IUUC-Cgl-026691 Colletotrichum gloeosporioides 71.25 1.00e-56 209.00
IUUC-Cne-026889 Cryptococcus neoformans 87.29 2.00e-58 215.00
IUUC-Cme-027158 Cyanidioschyzon merolae 27.50 1.30e+00 24.60
IUUC-Dre-027910 Danio rerio 59.32 9.00e-40 153.00
IUUC-Dno-029331 Dasypus novemcinctus 59.48 1.00e-39 152.00
IUUC-Dor-030453 Dipodomys ordii 59.48 2.00e-39 152.00
IUUC-Dse-031428 Dothistroma septosporum 97.46 5.00e-64 234.00
IUUC-Dme-031813 Drosophila melanogaster 61.21 9.00e-41 156.00
IUUC-Ete-032671 Echinops telfairi 59.48 2.00e-39 152.00
IUUC-Eca-034113 Equus caballus 59.48 2.00e-39 152.00
IUUC-Eeu-035131 Erinaceus europaeus 58.14 1.00e-26 108.00
IUUC-Fca-036385 Felis catus 59.48 2.00e-39 152.00
IUUC-Fal-036896 Ficedula albicollis 59.48 2.00e-39 152.00
IUUC-Fox-037846 Fusarium oxysporum 97.46 4.00e-64 234.00
IUUC-Fso-038134 Fusarium solani 98.31 2.00e-64 234.00
IUUC-Gmo-039671 Gadus morhua 58.47 1.00e-39 152.00
IUUC-Ggr-039770 Gaeumannomyces graminis 95.73 6.00e-62 227.00
IUUC-Gga-040257 Gallus gallus 59.48 2.00e-39 152.00
IUUC-Gac-041604 Gasterosteus aculeatus 59.48 6.00e-40 154.00
IUUC-Gma-044021 Glycine max 80.00 3.00e-52 194.00
IUUC-Ggo-044429 Gorilla gorilla 59.48 2.00e-39 152.00
IUUC-Hsa-046764 Homo sapiens 59.48 2.00e-39 152.00
IUUC-Hvu-047588 Hordeum vulgare 79.49 1.00e-51 192.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 59.48 4.00e-39 151.00
IUUC-Kpa-049124 Komagataella pastoris 83.76 1.00e-55 206.00
IUUC-Lch-049542 Latimeria chalumnae 58.62 1.00e-39 152.00
IUUC-Lpe-051292 Leersia perrieri 82.61 1.00e-52 196.00
IUUC-Loc-052290 Lepisosteus oculatus 59.48 2.00e-39 152.00
IUUC-Laf-054203 Loxodonta africana 59.48 4.00e-39 151.00
IUUC-Mcc-055307 Macaca mulatta 59.48 4.00e-39 151.00
IUUC-Meu-056515 Macropus eugenii 59.48 2.00e-39 152.00
IUUC-Mor-057276 Magnaporthe oryzae 94.07 2.00e-61 225.00
IUUC-Mpo-057469 Magnaporthe poae 95.73 5.00e-62 227.00
IUUC-Mtr-057664 Medicago truncatula 79.13 2.00e-46 175.00
IUUC-Mla-059098 Melampsora laricipopulina 90.52 6.00e-60 220.00
IUUC-Mga-060108 Meleagris gallopavo 54.70 2.00e-37 145.00
IUUC-Mvi-060496 Microbotryum violaceum 90.43 6.00e-58 213.00
IUUC-Mmr-061776 Microcebus murinus 59.48 4.00e-39 151.00
IUUC-Mdo-061915 Monodelphis domestica 59.48 2.00e-39 152.00
IUUC-Mmu-064152 Mus musculus 59.48 2.00e-39 152.00
IUUC-Mac-064739 Musa acuminata 78.63 4.00e-45 171.00
IUUC-Mpu-066760 Mustela putorius furo 59.48 1.00e-39 152.00
IUUC-Mlu-068211 Myotis lucifugus 59.48 2.00e-39 152.00
IUUC-Nfi-068367 Neosartorya fischeri 99.15 3.00e-65 238.00
IUUC-Ncr-068894 Neurospora crassa 98.29 5.00e-64 233.00
IUUC-Nle-069755 Nomascus leucogenys 59.48 2.00e-39 152.00
IUUC-Opr-070777 Ochotona princeps 59.48 4.00e-39 151.00
IUUC-Ont-072343 Oreochromis niloticus 58.62 9.00e-39 149.00
IUUC-Oan-073485 Ornithorhynchus anatinus 60.95 5.00e-36 140.00
IUUC-Ocu-073861 Oryctolagus cuniculus 59.48 2.00e-39 152.00
IUUC-Oba-075926 Oryza barthii 81.74 7.00e-52 193.00
IUUC-Obr-076830 Oryza brachyantha 81.74 1.00e-52 196.00
IUUC-Ogl-077457 Oryza glaberrima 81.74 7.00e-52 193.00
IUUC-Ogu-078078 Oryza glumaepatula 81.74 7.00e-52 193.00
IUUC-Oin-079771 Oryza indica 81.74 7.00e-52 193.00
IUUC-Olo-080412 Oryza longistaminata 81.74 7.00e-52 193.00
IUUC-Ome-081791 Oryza meridionalis 81.74 7.00e-52 193.00
IUUC-Oni-082774 Oryza nivara 81.74 7.00e-52 193.00
IUUC-Opu-083501 Oryza punctata 81.74 1.00e-52 196.00
IUUC-Oru-084425 Oryza rufipogon 80.00 2.00e-51 192.00
IUUC-Osa-085439 Oryza sativa 81.74 7.00e-52 193.00
IUUC-Ola-086310 Oryzias latipes 57.76 2.00e-38 149.00
IUUC-Olu-087892 Ostreococcus lucimarinus 81.25 2.00e-52 195.00
IUUC-Oga-088483 Otolemur garnettii 59.48 2.00e-39 152.00
IUUC-Oar-089989 Ovis aries 59.48 4.00e-39 151.00
IUUC-Ptr-091560 Pan troglodytes 59.48 2.00e-39 152.00
IUUC-Pan-092269 Papio anubis 59.48 2.00e-39 152.00
IUUC-Psi-093055 Pelodiscus sinensis 55.17 2.00e-37 145.00
IUUC-Pma-094337 Petromyzon marinus 57.76 2.00e-40 155.00
IUUC-Pno-095035 Phaeosphaeria nodorum 96.61 2.00e-63 231.00
IUUC-Ppa-095701 Physcomitrella patens 82.91 2.00e-47 179.00
IUUC-Pfo-096380 Poecilia formosa 57.76 1.00e-38 149.00
IUUC-Pab-098563 Pongo abelii 59.48 2.00e-39 152.00
IUUC-Pop-100069 Populus trichocarpa 81.74 5.00e-45 170.00
IUUC-Pca-100230 Procavia capensis 59.48 4.00e-39 151.00
IUUC-Ppe-101863 Prunus persica 81.74 2.00e-44 169.00
IUUC-Pva-103103 Pteropus vampyrus 55.17 2.00e-37 145.00
IUUC-Pte-104230 Pyrenophora teres 96.61 2.00e-63 231.00
IUUC-Rno-105111 Rattus norvegicus 59.48 2.00e-39 152.00
IUUC-Sce-106150 Saccharomyces cerevisiae 79.31 3.00e-52 194.00
IUUC-Sha-106656 Sarcophilus harrisii 59.48 4.00e-39 151.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 88.79 1.00e-57 213.00
IUUC-Spo-108156 Schizosaccharomyces pombe 86.21 1.00e-48 182.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 94.92 4.00e-63 230.00
IUUC-Smo-109082 Selaginella moellendorffii 80.87 1.00e-51 192.00
IUUC-Sit-110531 Setaria italica 81.58 3.00e-51 191.00
IUUC-Sly-111488 Solanum lycopersicum 80.87 4.00e-46 174.00
IUUC-Stu-112612 Solanum tuberosum 81.20 9.00e-53 196.00
IUUC-Sar-113670 Sorex araneus 54.31 1.00e-34 136.00
IUUC-Sbi-114346 Sorghum bicolor 81.74 7.00e-52 193.00
IUUC-Sre-114964 Sporisorium reilianum 86.21 1.00e-56 209.00
IUUC-Ssc-115828 Sus scrofa 59.48 2.00e-39 152.00
IUUC-Tgu-117195 Taeniopygia guttata 59.48 2.00e-39 152.00
IUUC-Tru-118632 Takifugu rubripes 58.47 1.00e-39 153.00
IUUC-Tsy-118919 Tarsius syrichta 55.17 2.00e-37 145.00
IUUC-Tni-120706 Tetraodon nigroviridis 57.76 4.00e-38 148.00
IUUC-Tca-121335 Theobroma cacao 79.13 5.00e-46 175.00
IUUC-Tre-122077 Trichoderma reesei 98.28 2.00e-63 232.00
IUUC-Tvi-122400 Trichoderma virens 98.28 2.00e-63 232.00
IUUC-Tae-122697 Triticum aestivum 78.95 3.00e-51 192.00
IUUC-Tur-126158 Triticum urartu 78.07 5.00e-51 190.00
IUUC-Tme-126955 Tuber melanosporum 98.28 2.00e-62 229.00
IUUC-Tbe-127765 Tupaia belangeri 62.79 4.00e-30 120.00
IUUC-Ttr-128205 Tursiops truncatus 59.48 2.00e-39 152.00
IUUC-Uma-129435 Ustilago maydis 86.21 1.00e-56 209.00
IUUC-Vda-129807 Verticillium dahliae 98.31 4.00e-65 237.00
IUUC-Vpa-130804 Vicugna pacos 58.62 4.00e-39 150.00
IUUC-Vvi-130830 Vitis vinifera 82.61 3.00e-46 174.00
IUUC-Xtr-132685 Xenopus tropicalis 59.48 1.00e-39 153.00
IUUC-Xma-133400 Xiphophorus maculatus 58.47 2.00e-39 152.00
IUUC-Yli-134327 Yarrowia lipolytica 90.68 1.00e-52 196.00
IUUC-Zma-135270 Zea mays 82.61 2.00e-52 195.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved