• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • miRecords
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • Drug & target
    • TTD
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Aca-004573
Ensembl Protein ID ENSACAP00000000061.2
UniProt Accession G1K889; G1K889_ANOCA
Protein Name Uncharacterized protein
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSACAG00000000062.3 ENSACAT00000000062.3 ENSACAP00000000061.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 3.10e-63 211.8 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk+ kyk+++l v+e++ +i++yk+lkp+++ +v+nDg+sreL++ltGtipv +rg+tynipi+lwll+tYP +PP+++vk
   Q: 2 AVSESQLKKMLGKYKYRDLSVQETISVIAQYKDLKPVMDGYVFNDGSSRELMSLTGTIPVSYRGNTYNIPICLWLLDTYPFNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    +++ m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSTM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLIGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Anolis carolinensis
Protein Sequence
(Fasta)
MAVSESQLKK MLGKYKYRDL SVQETISVIA QYKDLKPVMD GYVFNDGSSR ELMSLTGTIP 60
VSYRGNTYNI PICLWLLDTY PFNPPICFVK PTSTMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Aca-004573|UBD,UBD_UEV|Anolis carolinensis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TTCTTGGCAA AGTCTACGCT CCCGTCCGCG CAACGCACCA TGGGGCGGAA GTGACGTCAC 60
TCCGTAGCAC CGACCGGAAA CGGGCGGAGG CCAAGCTCTC GGAAGTGGCT TGAGGCAGTT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Aca-004573|UBD,UBD_UEV|Anolis carolinensis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

KEGG acs:100563646
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 27.96 2.00e-26 112.00
IUUC-Aml-002415 Ailuropoda melanoleuca 89.80 0.00e+00 696.00
IUUC-Atr-002875 Amborella trichopoda 30.66 8.00e-37 147.00
IUUC-Apl-003473 Anas platyrhynchos 88.01 0.00e+00 686.00
IUUC-Aly-006164 Arabidopsis lyrata 42.42 1.00e-20 94.00
IUUC-Ath-006575 Arabidopsis thaliana 42.42 9.00e-21 94.40
IUUC-Ago-007755 Ashbya gossypii 23.48 2.00e-05 43.10
IUUC-Acl-008218 Aspergillus clavatus 40.83 6.00e-26 112.00
IUUC-Afl-008597 Aspergillus flavus 42.50 7.00e-27 115.00
IUUC-Afu-009017 Aspergillus fumigatus 40.17 4.00e-24 106.00
IUUC-Ani-009468 Aspergillus nidulans 40.17 4.00e-21 96.30
IUUC-Ang-009755 Aspergillus niger 38.46 7.00e-23 102.00
IUUC-Aor-010072 Aspergillus oryzae 39.10 6.00e-27 115.00
IUUC-Ate-010400 Aspergillus terreus 38.76 1.00e-25 111.00
IUUC-Ame-011620 Astyanax mexicanus 82.61 0.00e+00 644.00
IUUC-Bgr-012136 Blumeria graminis 33.58 4.00e-22 99.40
IUUC-Bta-012557 Bos taurus 89.54 0.00e+00 700.00
IUUC-Bci-013881 Botrytis cinerea 37.59 6.00e-26 112.00
IUUC-Bdi-014325 Brachypodium distachyon 30.17 4.00e-14 72.00
IUUC-Bol-015144 Brassica oleracea 41.94 6.00e-27 113.00
IUUC-Bra-017605 Brassica rapa 40.50 6.00e-26 111.00
IUUC-Cel-018697 Caenorhabditis elegans 47.22 4.00e-38 152.00
IUUC-Cja-018963 Callithrix jacchus 86.01 0.00e+00 664.00
IUUC-Cfa-020472 Canis familiaris 89.54 0.00e+00 693.00
IUUC-Cpo-022001 Cavia porcellus 90.82 0.00e+00 701.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 35.81 2.00e-25 110.00
IUUC-Csa-023959 Chlorocebus sabaeus 90.82 0.00e+00 670.00
IUUC-Cho-024389 Choloepus hoffmanni 56.36 2.00e-37 149.00
IUUC-Cin-025688 Ciona intestinalis 46.15 7.00e-100 357.00
IUUC-Cne-026904 Cryptococcus neoformans 31.14 6.00e-17 82.00
IUUC-Cme-027280 Cyanidioschyzon merolae 37.40 7.00e-19 87.80
IUUC-Dre-027913 Danio rerio 82.10 1.00e-175 608.00
IUUC-Dno-029672 Dasypus novemcinctus 89.80 0.00e+00 693.00
IUUC-Dor-030175 Dipodomys ordii 89.05 1.00e-89 322.00
IUUC-Dse-031375 Dothistroma septosporum 32.85 9.00e-23 101.00
IUUC-Dme-031736 Drosophila melanogaster 46.14 2.00e-95 342.00
IUUC-Ete-032343 Echinops telfairi 85.20 0.00e+00 666.00
IUUC-Eca-033926 Equus caballus 90.05 0.00e+00 691.00
IUUC-Eeu-034940 Erinaceus europaeus 80.05 0.00e+00 656.00
IUUC-Fca-035491 Felis catus 89.29 0.00e+00 681.00
IUUC-Fal-037508 Ficedula albicollis 89.80 0.00e+00 691.00
IUUC-Fox-037937 Fusarium oxysporum 33.86 2.00e-21 97.10
IUUC-Fso-038091 Fusarium solani 36.84 9.00e-25 108.00
IUUC-Gmo-039427 Gadus morhua 79.54 2.00e-171 594.00
IUUC-Ggr-039724 Gaeumannomyces graminis 36.64 5.00e-23 102.00
IUUC-Gga-040998 Gallus gallus 86.77 0.00e+00 696.00
IUUC-Gac-041356 Gasterosteus aculeatus 79.95 0.00e+00 641.00
IUUC-Gma-043566 Glycine max 38.21 1.00e-25 110.00
IUUC-Ggo-044967 Gorilla gorilla 90.82 0.00e+00 670.00
IUUC-Hsa-046686 Homo sapiens 90.82 0.00e+00 670.00
IUUC-Hvu-047430 Hordeum vulgare 36.36 6.00e-21 94.70
IUUC-Itr-047929 Ictidomys tridecemlineatus 95.88 4.00e-106 376.00
IUUC-Kpa-049287 Komagataella pastoris 31.48 2.00e-17 83.20
IUUC-Lch-050597 Latimeria chalumnae 84.48 0.00e+00 677.00
IUUC-Lpe-051090 Leersia perrieri 36.36 2.00e-20 92.80
IUUC-Loc-052399 Lepisosteus oculatus 81.89 1.00e-175 608.00
IUUC-Lma-053249 Leptosphaeria maculans 29.82 9.00e-14 71.60
IUUC-Laf-053766 Loxodonta africana 90.56 0.00e+00 699.00
IUUC-Mcc-055641 Macaca mulatta 90.82 0.00e+00 670.00
IUUC-Meu-055919 Macropus eugenii 87.77 3.00e-165 573.00
IUUC-Mor-056970 Magnaporthe oryzae 38.58 2.00e-23 103.00
IUUC-Mpo-057345 Magnaporthe poae 37.98 2.00e-20 93.60
IUUC-Mtr-058436 Medicago truncatula 39.02 1.00e-26 113.00
IUUC-Mla-059037 Melampsora laricipopulina 36.43 3.00e-26 112.00
IUUC-Mga-059263 Meleagris gallopavo 85.94 0.00e+00 677.00
IUUC-Mvi-060463 Microbotryum violaceum 31.08 4.00e-18 86.30
IUUC-Mmr-060915 Microcebus murinus 90.31 0.00e+00 695.00
IUUC-Mdo-062449 Monodelphis domestica 88.01 0.00e+00 666.00
IUUC-Mmu-063151 Mus musculus 88.01 0.00e+00 680.00
IUUC-Mac-065020 Musa acuminata 36.22 1.00e-23 103.00
IUUC-Mpu-066621 Mustela putorius furo 89.80 0.00e+00 696.00
IUUC-Mlu-067336 Myotis lucifugus 90.56 0.00e+00 684.00
IUUC-Nfi-068530 Neosartorya fischeri 41.03 3.00e-24 106.00
IUUC-Ncr-068785 Neurospora crassa 35.34 2.00e-23 103.00
IUUC-Nle-069972 Nomascus leucogenys 90.82 0.00e+00 670.00
IUUC-Opr-071150 Ochotona princeps 60.46 9.00e-114 403.00
IUUC-Ont-071366 Oreochromis niloticus 81.33 0.00e+00 645.00
IUUC-Oan-073290 Ornithorhynchus anatinus 90.00 2.00e-105 374.00
IUUC-Ocu-074351 Oryctolagus cuniculus 90.56 0.00e+00 697.00
IUUC-Oba-075338 Oryza barthii 35.71 2.00e-11 63.20
IUUC-Obr-076135 Oryza brachyantha 36.36 1.00e-20 94.00
IUUC-Ogl-077182 Oryza glaberrima 35.40 1.00e-17 84.00
IUUC-Ogu-078281 Oryza glumaepatula 36.36 1.00e-20 94.00
IUUC-Oin-079068 Oryza indica 35.40 3.00e-17 82.80
IUUC-Olo-080460 Oryza longistaminata 27.61 5.00e-09 53.50
IUUC-Ome-081781 Oryza meridionalis 25.20 4.00e-18 85.50
IUUC-Oni-082517 Oryza nivara 24.93 7.00e-17 81.60
IUUC-Opu-084101 Oryza punctata 35.40 1.00e-17 84.00
IUUC-Oru-084556 Oryza rufipogon 35.96 2.00e-17 83.60
IUUC-Osa-086264 Oryza sativa 35.40 1.00e-17 84.00
IUUC-Ola-087252 Oryzias latipes 92.62 8.00e-69 251.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.12 3.00e-15 75.90
IUUC-Oga-088304 Otolemur garnettii 90.31 0.00e+00 696.00
IUUC-Oar-089734 Ovis aries 89.54 0.00e+00 700.00
IUUC-Ptr-091476 Pan troglodytes 90.82 0.00e+00 670.00
IUUC-Pan-092341 Papio anubis 90.82 0.00e+00 670.00
IUUC-Psi-093470 Pelodiscus sinensis 91.17 0.00e+00 677.00
IUUC-Pma-094143 Petromyzon marinus 64.21 2.00e-132 465.00
IUUC-Pno-095069 Phaeosphaeria nodorum 33.02 2.00e-14 74.30
IUUC-Ppa-095933 Physcomitrella patens 30.75 4.00e-39 155.00
IUUC-Pfo-096321 Poecilia formosa 81.59 2.00e-178 617.00
IUUC-Pab-098527 Pongo abelii 89.55 1.00e-170 592.00
IUUC-Pop-099323 Populus trichocarpa 27.65 3.00e-37 149.00
IUUC-Pca-101044 Procavia capensis 71.94 3.00e-148 517.00
IUUC-Ppe-101458 Prunus persica 41.67 2.00e-27 116.00
IUUC-Pva-103014 Pteropus vampyrus 80.10 2.00e-165 574.00
IUUC-Pgr-103615 Puccinia graminis 37.59 6.00e-22 98.60
IUUC-Ptt-103826 Puccinia triticina 40.59 6.00e-17 82.00
IUUC-Pte-104171 Pyrenophora teres 35.29 1.00e-21 97.40
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 3.00e-10 59.70
IUUC-Rno-105957 Rattus norvegicus 86.99 0.00e+00 672.00
IUUC-Sce-106262 Saccharomyces cerevisiae 26.12 1.00e-11 63.50
IUUC-Sha-107607 Sarcophilus harrisii 89.71 1.00e-170 591.00
IUUC-Spo-108175 Schizosaccharomyces pombe 23.33 2.60e-01 30.00
IUUC-Ssl-108672 Sclerotinia sclerotiorum 36.09 4.00e-25 109.00
IUUC-Smo-108973 Selaginella moellendorffii 38.46 4.00e-22 98.60
IUUC-Sly-111373 Solanum lycopersicum 37.40 3.00e-24 105.00
IUUC-Stu-112844 Solanum tuberosum 36.59 4.00e-23 102.00
IUUC-Sar-113653 Sorex araneus 77.44 5.00e-167 580.00
IUUC-Sbi-114390 Sorghum bicolor 34.71 1.00e-20 94.00
IUUC-Sre-115200 Sporisorium reilianum 39.04 4.00e-25 109.00
IUUC-Ssc-115888 Sus scrofa 91.23 2.00e-108 384.00
IUUC-Tgu-117506 Taeniopygia guttata 89.09 0.00e+00 701.00
IUUC-Tru-118063 Takifugu rubripes 80.15 4.00e-173 600.00
IUUC-Tsy-118851 Tarsius syrichta 66.39 6.00e-131 460.00
IUUC-Tni-120010 Tetraodon nigroviridis 80.46 5.00e-173 600.00
IUUC-Tca-121182 Theobroma cacao 39.84 3.00e-22 99.40
IUUC-Tre-122040 Trichoderma reesei 37.80 4.00e-22 99.40
IUUC-Tvi-122660 Trichoderma virens 41.35 5.00e-26 112.00
IUUC-Tae-124561 Triticum aestivum 27.96 2.00e-26 112.00
IUUC-Tur-126651 Triticum urartu 36.36 1.00e-20 93.60
IUUC-Tme-127184 Tuber melanosporum 47.32 6.00e-26 112.00
IUUC-Tbe-127894 Tupaia belangeri 96.60 3.00e-79 288.00
IUUC-Ttr-128264 Tursiops truncatus 79.31 0.00e+00 646.00
IUUC-Uma-129407 Ustilago maydis 38.36 1.00e-25 111.00
IUUC-Vda-130002 Verticillium dahliae 32.06 9.00e-16 78.20
IUUC-Vpa-130156 Vicugna pacos 85.07 1.00e-89 323.00
IUUC-Vvi-131062 Vitis vinifera 29.54 4.00e-34 138.00
IUUC-Xtr-132332 Xenopus tropicalis 81.68 2.00e-63 234.00
IUUC-Xma-133186 Xiphophorus maculatus 80.31 2.00e-179 621.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 6.00e-13 68.20
IUUC-Zma-135391 Zea mays 35.29 2.00e-20 92.80
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved