• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • miRecords
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • Drug & target
    • TTD
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Eca-033926
Ensembl Protein ID ENSECAP00000004256.1
UniProt Accession F6ZA94; F6ZA94_HORSE
Protein Name Uncharacterized protein
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSECAG00000004362.1 ENSECAT00000006044.1 ENSECAP00000004256.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 4.80e-68 227.6 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk++skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp+rg++ynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVVDSYVFNDGSSRELMNLTGTIPVPYRGNIYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Equus caballus
Protein Sequence
(Fasta)
MAVSESQLKK MVSKYKYRDL TVRETVNVIT LYKDLKPVVD SYVFNDGSSR ELMNLTGTIP 60
VPYRGNIYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Eca-033926|UBD,UBD_UEV|Equus caballus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TTGTGCGGGG CGGCTTGGGC AGCCCGGGAG CGGCTGACCC TCTGCCTGCG GGGACGGGAG 60
TCGCGAGGCG GCCGCCATGG CGGTGTCGGA GAGCCAGCTC AAGAAAATGG TGTCCAAGGT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Eca-033926|UBD,UBD_UEV|Equus caballus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

KEGG ecb:100057099
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 26.36 7.00e-27 114.00
IUUC-Aml-002415 Ailuropoda melanoleuca 98.21 0.00e+00 726.00
IUUC-Atr-002875 Amborella trichopoda 29.78 5.00e-37 148.00
IUUC-Apl-003473 Anas platyrhynchos 87.76 0.00e+00 676.00
IUUC-Aca-004573 Anolis carolinensis 90.05 0.00e+00 663.00
IUUC-Aly-006164 Arabidopsis lyrata 37.87 2.00e-21 96.70
IUUC-Ath-006575 Arabidopsis thaliana 31.52 1.00e-32 133.00
IUUC-Ago-007755 Ashbya gossypii 24.40 1.00e-05 44.30
IUUC-Acl-008218 Aspergillus clavatus 38.76 9.00e-26 111.00
IUUC-Afl-008597 Aspergillus flavus 39.10 7.00e-26 112.00
IUUC-Afu-009017 Aspergillus fumigatus 37.98 1.00e-23 104.00
IUUC-Ani-009468 Aspergillus nidulans 38.64 2.00e-21 97.10
IUUC-Ang-009755 Aspergillus niger 36.51 6.00e-23 102.00
IUUC-Aor-010072 Aspergillus oryzae 37.59 6.00e-26 112.00
IUUC-Ate-010400 Aspergillus terreus 38.76 2.00e-25 110.00
IUUC-Ame-011620 Astyanax mexicanus 79.74 0.00e+00 633.00
IUUC-Bgr-012136 Blumeria graminis 35.04 3.00e-23 103.00
IUUC-Bta-012557 Bos taurus 97.95 0.00e+00 747.00
IUUC-Bci-013881 Botrytis cinerea 36.03 1.00e-25 110.00
IUUC-Bdi-014325 Brachypodium distachyon 31.03 7.00e-14 71.20
IUUC-Bol-016308 Brassica oleracea 40.80 5.00e-26 112.00
IUUC-Bra-017442 Brassica rapa 42.24 2.00e-23 103.00
IUUC-Cel-018697 Caenorhabditis elegans 48.84 4.00e-37 149.00
IUUC-Cja-018963 Callithrix jacchus 91.82 0.00e+00 726.00
IUUC-Cfa-020472 Canis familiaris 98.72 0.00e+00 727.00
IUUC-Cpo-022001 Cavia porcellus 98.47 0.00e+00 728.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 29.89 9.00e-31 127.00
IUUC-Csa-023959 Chlorocebus sabaeus 98.46 0.00e+00 705.00
IUUC-Cho-024389 Choloepus hoffmanni 56.36 7.00e-38 151.00
IUUC-Cin-025688 Ciona intestinalis 43.77 7.00e-97 347.00
IUUC-Cne-026904 Cryptococcus neoformans 28.35 7.00e-16 78.60
IUUC-Cme-027280 Cyanidioschyzon merolae 39.09 2.00e-17 83.20
IUUC-Dre-027913 Danio rerio 80.00 4.00e-174 603.00
IUUC-Dno-029672 Dasypus novemcinctus 97.44 0.00e+00 731.00
IUUC-Dor-030175 Dipodomys ordii 97.50 6.00e-94 337.00
IUUC-Dse-031375 Dothistroma septosporum 33.33 1.00e-22 100.00
IUUC-Dme-031736 Drosophila melanogaster 47.46 9.00e-98 350.00
IUUC-Ete-032343 Echinops telfairi 92.07 0.00e+00 687.00
IUUC-Eeu-034940 Erinaceus europaeus 90.54 0.00e+00 710.00
IUUC-Fca-035491 Felis catus 97.95 0.00e+00 710.00
IUUC-Fal-037508 Ficedula albicollis 90.31 0.00e+00 674.00
IUUC-Fox-037937 Fusarium oxysporum 31.54 8.00e-21 95.10
IUUC-Fso-038091 Fusarium solani 35.29 2.00e-24 107.00
IUUC-Gmo-039427 Gadus morhua 78.72 2.00e-169 588.00
IUUC-Ggr-039724 Gaeumannomyces graminis 36.57 2.00e-24 107.00
IUUC-Gga-040998 Gallus gallus 89.29 0.00e+00 705.00
IUUC-Gac-041356 Gasterosteus aculeatus 80.15 0.00e+00 632.00
IUUC-Gma-043566 Glycine max 38.89 1.00e-24 107.00
IUUC-Ggo-044967 Gorilla gorilla 98.46 0.00e+00 705.00
IUUC-Hsa-046686 Homo sapiens 98.46 0.00e+00 705.00
IUUC-Hvu-047430 Hordeum vulgare 26.60 1.00e-26 114.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 98.21 1.00e-110 392.00
IUUC-Kpa-049287 Komagataella pastoris 25.06 5.00e-27 115.00
IUUC-Lch-050597 Latimeria chalumnae 86.99 0.00e+00 701.00
IUUC-Lpe-051090 Leersia perrieri 38.02 5.00e-20 92.00
IUUC-Loc-052399 Lepisosteus oculatus 78.52 2.00e-176 611.00
IUUC-Lma-053249 Leptosphaeria maculans 28.95 6.00e-13 68.90
IUUC-Laf-053766 Loxodonta africana 98.47 0.00e+00 728.00
IUUC-Mcc-055641 Macaca mulatta 98.46 0.00e+00 705.00
IUUC-Meu-055919 Macropus eugenii 90.18 3.00e-168 584.00
IUUC-Mor-056970 Magnaporthe oryzae 37.69 2.00e-23 103.00
IUUC-Mpo-057345 Magnaporthe poae 36.15 3.00e-22 99.80
IUUC-Mtr-058436 Medicago truncatula 28.76 3.00e-32 132.00
IUUC-Mla-059037 Melampsora laricipopulina 34.93 3.00e-25 109.00
IUUC-Mga-059263 Meleagris gallopavo 88.83 0.00e+00 683.00
IUUC-Mvi-060463 Microbotryum violaceum 29.53 1.00e-16 81.60
IUUC-Mmr-060915 Microcebus murinus 97.70 0.00e+00 721.00
IUUC-Mdo-062449 Monodelphis domestica 94.37 0.00e+00 685.00
IUUC-Mmu-063151 Mus musculus 94.63 0.00e+00 698.00
IUUC-Mac-065581 Musa acuminata 36.43 1.00e-21 97.40
IUUC-Mpu-066621 Mustela putorius furo 98.21 0.00e+00 726.00
IUUC-Mlu-067336 Myotis lucifugus 97.19 0.00e+00 703.00
IUUC-Nfi-068530 Neosartorya fischeri 38.76 7.00e-24 105.00
IUUC-Ncr-068785 Neurospora crassa 35.29 4.00e-24 105.00
IUUC-Nle-069972 Nomascus leucogenys 98.46 0.00e+00 705.00
IUUC-Opr-071150 Ochotona princeps 68.03 2.00e-121 428.00
IUUC-Ont-071366 Oreochromis niloticus 81.33 0.00e+00 630.00
IUUC-Oan-073290 Ornithorhynchus anatinus 93.91 5.00e-105 373.00
IUUC-Ocu-074351 Oryctolagus cuniculus 98.21 0.00e+00 725.00
IUUC-Oba-075338 Oryza barthii 37.14 4.00e-11 62.00
IUUC-Obr-076135 Oryza brachyantha 37.19 7.00e-20 91.30
IUUC-Ogl-077182 Oryza glaberrima 36.28 8.00e-17 81.30
IUUC-Ogu-078281 Oryza glumaepatula 27.20 3.00e-20 92.40
IUUC-Oin-079068 Oryza indica 36.28 2.00e-16 80.50
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.40
IUUC-Ome-081781 Oryza meridionalis 26.27 2.00e-17 83.60
IUUC-Oni-082517 Oryza nivara 25.99 4.00e-16 79.30
IUUC-Opu-084101 Oryza punctata 36.28 7.00e-17 81.30
IUUC-Oru-084556 Oryza rufipogon 36.28 1.00e-16 81.30
IUUC-Osa-086264 Oryza sativa 36.28 9.00e-17 81.30
IUUC-Ola-087252 Oryzias latipes 92.62 3.00e-69 253.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.25 8.00e-15 74.70
IUUC-Oga-088304 Otolemur garnettii 97.70 0.00e+00 719.00
IUUC-Oar-089734 Ovis aries 97.95 0.00e+00 747.00
IUUC-Ptr-091476 Pan troglodytes 98.46 0.00e+00 705.00
IUUC-Pan-092341 Papio anubis 98.46 0.00e+00 705.00
IUUC-Psi-093470 Pelodiscus sinensis 92.21 0.00e+00 662.00
IUUC-Pma-094143 Petromyzon marinus 64.64 2.00e-133 468.00
IUUC-Pno-095069 Phaeosphaeria nodorum 31.09 1.00e-13 71.20
IUUC-Ppa-095933 Physcomitrella patens 31.03 1.00e-38 154.00
IUUC-Pfo-096321 Poecilia formosa 82.10 2.00e-174 604.00
IUUC-Pab-098527 Pongo abelii 97.73 1.00e-180 625.00
IUUC-Pop-099323 Populus trichocarpa 26.94 4.00e-36 145.00
IUUC-Pca-101044 Procavia capensis 80.05 4.00e-157 547.00
IUUC-Ppe-101458 Prunus persica 40.83 2.00e-26 112.00
IUUC-Pva-103014 Pteropus vampyrus 88.24 2.00e-172 598.00
IUUC-Pgr-103615 Puccinia graminis 36.09 6.00e-20 92.00
IUUC-Ptt-103826 Puccinia triticina 40.20 4.00e-16 79.30
IUUC-Pte-104171 Pyrenophora teres 34.56 7.00e-21 95.50
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.10
IUUC-Rno-105957 Rattus norvegicus 93.61 0.00e+00 691.00
IUUC-Sce-106262 Saccharomyces cerevisiae 28.86 6.00e-10 58.50
IUUC-Sha-107607 Sarcophilus harrisii 94.84 2.00e-172 597.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.30e-02 34.30
IUUC-Ssl-108672 Sclerotinia sclerotiorum 36.03 4.00e-26 112.00
IUUC-Smo-108973 Selaginella moellendorffii 39.47 1.00e-20 94.00
IUUC-Sly-111373 Solanum lycopersicum 35.71 5.00e-23 102.00
IUUC-Stu-112844 Solanum tuberosum 35.71 1.00e-22 100.00
IUUC-Sar-113653 Sorex araneus 82.22 7.00e-178 616.00
IUUC-Sbi-114390 Sorghum bicolor 27.27 3.00e-26 112.00
IUUC-Sre-115200 Sporisorium reilianum 37.67 1.00e-23 104.00
IUUC-Ssc-115888 Sus scrofa 100.00 6.00e-114 402.00
IUUC-Tgu-117506 Taeniopygia guttata 88.83 0.00e+00 686.00
IUUC-Tru-118063 Takifugu rubripes 78.57 4.00e-169 587.00
IUUC-Tsy-118851 Tarsius syrichta 74.71 2.00e-142 498.00
IUUC-Tni-120010 Tetraodon nigroviridis 77.58 7.00e-168 583.00
IUUC-Tca-121182 Theobroma cacao 38.10 1.00e-21 97.10
IUUC-Tre-122040 Trichoderma reesei 35.38 3.00e-21 96.70
IUUC-Tvi-122660 Trichoderma virens 38.97 4.00e-25 109.00
IUUC-Tae-124561 Triticum aestivum 26.36 7.00e-27 114.00
IUUC-Tur-126651 Triticum urartu 36.59 3.00e-20 92.40
IUUC-Tme-127184 Tuber melanosporum 46.43 5.00e-25 108.00
IUUC-Tbe-127894 Tupaia belangeri 82.50 9.00e-90 323.00
IUUC-Ttr-128264 Tursiops truncatus 89.26 0.00e+00 698.00
IUUC-Uma-129407 Ustilago maydis 36.30 4.00e-24 106.00
IUUC-Vda-130002 Verticillium dahliae 30.14 2.00e-15 77.40
IUUC-Vpa-130156 Vicugna pacos 97.00 2.00e-94 338.00
IUUC-Vvi-131062 Vitis vinifera 29.10 1.00e-32 133.00
IUUC-Xtr-132332 Xenopus tropicalis 80.92 1.00e-62 231.00
IUUC-Xma-133186 Xiphophorus maculatus 81.84 9.00e-178 615.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 8.00e-13 67.80
IUUC-Zma-135391 Zea mays 36.13 2.00e-19 90.10
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved