• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • miRecords
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • Drug & target
    • TTD
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Fal-037508
Ensembl Protein ID ENSFALP00000011680.1
UniProt Accession U3K9H6; U3K9H6_FICAL
Genbank Protein ID ENSFALP00000011680
Protein Name Uncharacterized protein
Genbank Nucleotide ID AGTO01020824
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSFALG00000011179.1 ENSFALT00000011728.1 ENSFALP00000011680.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 2.30e-65 218.5 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk+ +kyk+++lt++e+ +i++yk+lkp+++s+v+nDg+sreL++l Gtipvp+rg+tynipi+lwll+tYP +PP+++vk
   Q: 2 AVSESQLKKMLTKYKYRDLTIQETTSVITQYKDLKPVMDSYVFNDGSSRELMSLSGTIPVPYRGNTYNIPICLWLLDTYPFNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+el+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKYPQSDLLELIQVMIVVFGEEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Ficedula albicollis
Protein Sequence
(Fasta)
MAVSESQLKK MLTKYKYRDL TIQETTSVIT QYKDLKPVMD SYVFNDGSSR ELMSLSGTIP 60
VPYRGNTYNI PICLWLLDTY PFNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKYP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Fal-037508|UBD,UBD_UEV|Ficedula albicollis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGCGGTGT CCGAGAGCCA GCTCAAGAAG ATGCTCACCA AGGTACCGGC CGGGCTCGGC 60
CAGCGGGGCC CGGCGCCGGG AGGCTCCGGA GAGTTGGGTC GGGAGGGGAG GAACCAGCTT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Fal-037508|UBD,UBD_UEV|Ficedula albicollis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

KEGG fab:101806433
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 39.13 6.00e-22 98.20
IUUC-Aml-002415 Ailuropoda melanoleuca 90.05 0.00e+00 693.00
IUUC-Atr-002875 Amborella trichopoda 29.40 5.00e-37 148.00
IUUC-Apl-003473 Anas platyrhynchos 93.62 0.00e+00 718.00
IUUC-Aca-004573 Anolis carolinensis 89.80 0.00e+00 676.00
IUUC-Aly-006164 Arabidopsis lyrata 44.12 2.00e-22 99.80
IUUC-Ath-006575 Arabidopsis thaliana 45.10 1.00e-22 100.00
IUUC-Ago-007755 Ashbya gossypii 20.53 6.00e-06 45.10
IUUC-Acl-008218 Aspergillus clavatus 37.98 1.00e-25 111.00
IUUC-Afl-008597 Aspergillus flavus 39.53 1.00e-26 114.00
IUUC-Afu-009017 Aspergillus fumigatus 36.51 1.00e-23 104.00
IUUC-Ani-009468 Aspergillus nidulans 39.53 1.00e-21 97.80
IUUC-Ang-009755 Aspergillus niger 35.71 6.00e-23 102.00
IUUC-Aor-010072 Aspergillus oryzae 38.35 9.00e-27 114.00
IUUC-Ate-010400 Aspergillus terreus 38.76 4.00e-26 112.00
IUUC-Ame-011620 Astyanax mexicanus 81.84 0.00e+00 631.00
IUUC-Bgr-012136 Blumeria graminis 35.21 2.00e-24 106.00
IUUC-Bta-012557 Bos taurus 89.80 0.00e+00 702.00
IUUC-Bci-013881 Botrytis cinerea 39.85 5.00e-28 119.00
IUUC-Bdi-014325 Brachypodium distachyon 31.03 2.00e-15 76.30
IUUC-Bol-016308 Brassica oleracea 41.67 1.00e-27 117.00
IUUC-Bra-017605 Brassica rapa 41.94 8.00e-28 117.00
IUUC-Cel-018697 Caenorhabditis elegans 45.83 3.00e-37 149.00
IUUC-Cja-018963 Callithrix jacchus 82.35 0.00e+00 663.00
IUUC-Cfa-020472 Canis familiaris 89.80 0.00e+00 687.00
IUUC-Cpo-022001 Cavia porcellus 91.33 0.00e+00 696.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 34.25 3.00e-25 109.00
IUUC-Csa-023959 Chlorocebus sabaeus 91.58 0.00e+00 668.00
IUUC-Cho-024389 Choloepus hoffmanni 54.55 4.00e-37 149.00
IUUC-Cin-025688 Ciona intestinalis 45.64 9.00e-99 353.00
IUUC-Cne-026904 Cryptococcus neoformans 31.07 2.00e-16 80.10
IUUC-Cme-027280 Cyanidioschyzon merolae 36.30 8.00e-20 90.90
IUUC-Dre-027913 Danio rerio 82.35 8.00e-173 599.00
IUUC-Dno-029672 Dasypus novemcinctus 84.56 0.00e+00 687.00
IUUC-Dor-030175 Dipodomys ordii 89.55 4.00e-89 320.00
IUUC-Dse-031375 Dothistroma septosporum 34.31 1.00e-24 107.00
IUUC-Dme-031736 Drosophila melanogaster 47.00 1.00e-96 346.00
IUUC-Ete-032343 Echinops telfairi 86.99 0.00e+00 666.00
IUUC-Eca-033926 Equus caballus 90.31 0.00e+00 686.00
IUUC-Eeu-034940 Erinaceus europaeus 80.84 0.00e+00 655.00
IUUC-Fca-035491 Felis catus 89.80 0.00e+00 679.00
IUUC-Fox-037937 Fusarium oxysporum 32.31 2.00e-22 99.80
IUUC-Fso-038091 Fusarium solani 36.03 5.00e-26 112.00
IUUC-Gmo-039427 Gadus morhua 76.73 8.00e-168 582.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.31 2.00e-25 110.00
IUUC-Gga-040998 Gallus gallus 93.11 0.00e+00 734.00
IUUC-Gac-041356 Gasterosteus aculeatus 78.23 0.00e+00 630.00
IUUC-Gma-043566 Glycine max 40.48 6.00e-27 114.00
IUUC-Ggo-044967 Gorilla gorilla 91.58 0.00e+00 668.00
IUUC-Hsa-046686 Homo sapiens 91.58 0.00e+00 668.00
IUUC-Hvu-047430 Hordeum vulgare 39.13 5.00e-22 98.60
IUUC-Itr-047929 Ictidomys tridecemlineatus 97.94 2.00e-107 380.00
IUUC-Kpa-049287 Komagataella pastoris 31.48 4.00e-18 85.90
IUUC-Lch-050597 Latimeria chalumnae 84.95 0.00e+00 672.00
IUUC-Lpe-051090 Leersia perrieri 36.22 2.00e-21 96.70
IUUC-Loc-052399 Lepisosteus oculatus 82.91 6.00e-174 602.00
IUUC-Lma-053249 Leptosphaeria maculans 31.58 4.00e-14 72.80
IUUC-Laf-053766 Loxodonta africana 90.82 0.00e+00 694.00
IUUC-Mcc-055641 Macaca mulatta 91.58 0.00e+00 668.00
IUUC-Meu-055919 Macropus eugenii 87.46 4.00e-163 566.00
IUUC-Mor-056970 Magnaporthe oryzae 37.69 5.00e-25 108.00
IUUC-Mpo-057345 Magnaporthe poae 36.15 6.00e-23 101.00
IUUC-Mtr-058436 Medicago truncatula 40.48 8.00e-28 117.00
IUUC-Mla-059037 Melampsora laricipopulina 38.62 3.00e-28 119.00
IUUC-Mga-059263 Meleagris gallopavo 92.71 0.00e+00 714.00
IUUC-Mvi-060463 Microbotryum violaceum 30.82 8.00e-19 88.60
IUUC-Mmr-060915 Microcebus murinus 90.56 0.00e+00 692.00
IUUC-Mdo-062449 Monodelphis domestica 88.27 0.00e+00 660.00
IUUC-Mmu-063151 Mus musculus 88.52 0.00e+00 677.00
IUUC-Mac-065581 Musa acuminata 36.43 3.00e-23 102.00
IUUC-Mpu-066621 Mustela putorius furo 90.05 0.00e+00 693.00
IUUC-Mlu-067336 Myotis lucifugus 90.56 0.00e+00 676.00
IUUC-Nfi-068530 Neosartorya fischeri 37.98 8.00e-24 105.00
IUUC-Ncr-068785 Neurospora crassa 36.03 7.00e-26 111.00
IUUC-Nle-069972 Nomascus leucogenys 91.58 0.00e+00 668.00
IUUC-Opr-071150 Ochotona princeps 61.73 1.00e-114 406.00
IUUC-Ont-071366 Oreochromis niloticus 80.26 0.00e+00 630.00
IUUC-Oan-073290 Ornithorhynchus anatinus 95.36 4.00e-105 373.00
IUUC-Ocu-074351 Oryctolagus cuniculus 91.33 0.00e+00 696.00
IUUC-Oba-075338 Oryza barthii 39.06 2.00e-11 63.20
IUUC-Obr-076135 Oryza brachyantha 35.43 3.00e-21 95.90
IUUC-Ogl-077182 Oryza glaberrima 35.96 3.00e-18 85.90
IUUC-Ogu-078281 Oryza glumaepatula 35.43 2.00e-21 96.30
IUUC-Oin-079068 Oryza indica 37.38 7.00e-18 85.10
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.40
IUUC-Ome-081781 Oryza meridionalis 36.21 1.00e-18 87.40
IUUC-Oni-082517 Oryza nivara 35.29 2.00e-17 83.20
IUUC-Opu-084101 Oryza punctata 35.00 3.00e-18 85.90
IUUC-Oru-084556 Oryza rufipogon 37.96 3.00e-18 85.90
IUUC-Osa-086264 Oryza sativa 37.96 3.00e-18 85.90
IUUC-Ola-087252 Oryzias latipes 92.62 9.00e-69 251.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.73 2.00e-15 76.30
IUUC-Oga-088304 Otolemur garnettii 90.82 0.00e+00 692.00
IUUC-Oar-089734 Ovis aries 89.80 0.00e+00 702.00
IUUC-Ptr-091476 Pan troglodytes 91.58 0.00e+00 668.00
IUUC-Pan-092341 Papio anubis 91.58 0.00e+00 668.00
IUUC-Psi-093470 Pelodiscus sinensis 91.43 0.00e+00 673.00
IUUC-Pma-094143 Petromyzon marinus 64.23 9.00e-132 462.00
IUUC-Pno-095069 Phaeosphaeria nodorum 34.91 1.00e-14 74.70
IUUC-Ppa-095933 Physcomitrella patens 30.89 7.00e-39 154.00
IUUC-Pfo-096321 Poecilia formosa 80.56 1.00e-174 605.00
IUUC-Pab-098527 Pongo abelii 90.40 5.00e-170 590.00
IUUC-Pop-099323 Populus trichocarpa 27.15 2.00e-37 149.00
IUUC-Pca-101044 Procavia capensis 72.19 5.00e-148 516.00
IUUC-Ppe-101458 Prunus persica 41.35 4.00e-29 122.00
IUUC-Pva-103014 Pteropus vampyrus 80.36 3.00e-163 567.00
IUUC-Pgr-103615 Puccinia graminis 38.35 8.00e-23 101.00
IUUC-Ptt-103826 Puccinia triticina 39.60 4.00e-17 82.40
IUUC-Pte-104171 Pyrenophora teres 35.29 6.00e-23 102.00
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.10
IUUC-Rno-105957 Rattus norvegicus 87.76 0.00e+00 671.00
IUUC-Sce-106262 Saccharomyces cerevisiae 26.98 1.00e-11 63.90
IUUC-Sha-107607 Sarcophilus harrisii 90.29 2.00e-169 588.00
IUUC-Spo-108175 Schizosaccharomyces pombe 29.63 3.90e-02 32.70
IUUC-Ssl-108672 Sclerotinia sclerotiorum 38.35 5.00e-27 115.00
IUUC-Smo-108973 Selaginella moellendorffii 38.46 3.00e-22 99.40
IUUC-Sly-111373 Solanum lycopersicum 39.53 1.00e-25 110.00
IUUC-Stu-112844 Solanum tuberosum 38.76 1.00e-24 107.00
IUUC-Sar-113653 Sorex araneus 78.46 2.00e-168 585.00
IUUC-Sbi-114390 Sorghum bicolor 33.86 2.00e-21 96.30
IUUC-Sre-115200 Sporisorium reilianum 38.16 2.00e-25 110.00
IUUC-Ssc-115888 Sus scrofa 91.67 5.00e-108 382.00
IUUC-Tgu-117506 Taeniopygia guttata 97.72 0.00e+00 756.00
IUUC-Tru-118063 Takifugu rubripes 79.34 4.00e-169 587.00
IUUC-Tsy-118851 Tarsius syrichta 66.76 1.00e-129 455.00
IUUC-Tni-120010 Tetraodon nigroviridis 79.13 4.00e-168 583.00
IUUC-Tca-121182 Theobroma cacao 41.27 2.00e-24 106.00
IUUC-Tre-122040 Trichoderma reesei 35.38 6.00e-23 102.00
IUUC-Tvi-122660 Trichoderma virens 38.24 2.00e-26 113.00
IUUC-Tae-124561 Triticum aestivum 39.13 6.00e-22 98.20
IUUC-Tur-126651 Triticum urartu 39.13 7.00e-22 97.40
IUUC-Tme-127184 Tuber melanosporum 48.21 2.00e-26 113.00
IUUC-Tbe-127894 Tupaia belangeri 99.32 2.00e-80 291.00
IUUC-Ttr-128264 Tursiops truncatus 80.59 0.00e+00 649.00
IUUC-Uma-129407 Ustilago maydis 38.36 3.00e-26 113.00
IUUC-Vda-130002 Verticillium dahliae 30.41 6.00e-18 85.50
IUUC-Vpa-130156 Vicugna pacos 83.58 4.00e-87 314.00
IUUC-Vvi-131062 Vitis vinifera 28.49 2.00e-33 135.00
IUUC-Xtr-132332 Xenopus tropicalis 81.68 8.00e-63 231.00
IUUC-Xma-133186 Xiphophorus maculatus 80.31 3.00e-176 610.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 4.00e-13 68.60
IUUC-Zma-135391 Zea mays 34.40 5.00e-21 95.10
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved