• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • miRecords
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • Drug & target
    • TTD
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Mga-059263
Ensembl Protein ID ENSMGAP00000007579.1
UniProt Accession G1N6A3; G1N6A3_MELGA
Protein Name Uncharacterized protein
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMGAG00000007434.1 ENSMGAT00000008357.1 ENSMGAP00000007579.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 1.60e-60 202.8 12 147
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 9    kvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvkekidmnti 97
    k skyk+++lt++e+ +i++yk+lkp+++s+v+nDg+sreL++l Gtipvp+rg++ynipi+lwll+tYP +PP+++vk++++m ti
   Q: 12 KSHSKYKYRDLTIQETNSVISQYKDLKPVMDSYVFNDGSSRELMSLSGTIPVPYRGNIYNIPICLWLLDTYPFNPPICFVKPTSSM-TI 99
    44689*********************************************************************************.** PP
   S: 98 kssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    k++ +hvd+nGki+lp+Lh+Wk+p+s+l+el+q++iv++++epp++srp
   Q: 100 KTG-KHVDANGKIYLPYLHEWKYPQSDLLELIQVMIVVFAEEPPVFSRP 147
    ***.*******************************************98 PP
   

Organism Meleagris gallopavo
Protein Sequence
(Fasta)
QSVWFDYVKK IKSHSKYKYR DLTIQETNSV ISQYKDLKPV MDSYVFNDGS SRELMSLSGT 60
IPVPYRGNIY NIPICLWLLD TYPFNPPICF VKPTSSMTIK TGKHVDANGK IYLPYLHEWK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mga-059263|UBD,UBD_UEV|Meleagris gallopavo
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CAGAGTGTTT GGTTTGATTA TGTAAAAAAA ATAAAATCTC ACTCAAAAGT AAGAGTGCAG 60
AAGAATGCCC ATCTATAACT TCCATAAACA GAGGCTATTC TGTGAAACAA AAAGCAATTT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mga-059263|UBD,UBD_UEV|Meleagris gallopavo
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 35.83 2.00e-20 92.80
IUUC-Aml-002415 Ailuropoda melanoleuca 85.97 0.00e+00 658.00
IUUC-Atr-002875 Amborella trichopoda 30.56 7.00e-38 150.00
IUUC-Apl-003473 Anas platyrhynchos 94.56 0.00e+00 717.00
IUUC-Aca-004573 Anolis carolinensis 84.11 0.00e+00 642.00
IUUC-Aly-006164 Arabidopsis lyrata 41.67 1.00e-21 96.70
IUUC-Ath-006575 Arabidopsis thaliana 31.71 9.00e-33 134.00
IUUC-Ago-007755 Ashbya gossypii 22.73 6.00e-06 45.10
IUUC-Acl-008218 Aspergillus clavatus 38.76 3.00e-26 113.00
IUUC-Afl-008597 Aspergillus flavus 40.60 2.00e-27 117.00
IUUC-Afu-009017 Aspergillus fumigatus 37.98 3.00e-24 106.00
IUUC-Ani-009468 Aspergillus nidulans 40.91 2.00e-22 99.80
IUUC-Ang-009755 Aspergillus niger 36.51 1.00e-23 104.00
IUUC-Aor-010072 Aspergillus oryzae 40.31 3.00e-27 115.00
IUUC-Ate-010400 Aspergillus terreus 40.31 6.00e-27 115.00
IUUC-Ame-011620 Astyanax mexicanus 80.73 5.00e-179 619.00
IUUC-Bgr-012136 Blumeria graminis 37.78 4.00e-24 105.00
IUUC-Bta-012557 Bos taurus 88.05 0.00e+00 669.00
IUUC-Bci-013881 Botrytis cinerea 39.57 8.00e-28 118.00
IUUC-Bdi-014001 Brachypodium distachyon 36.17 8.00e-13 67.40
IUUC-Bol-015933 Brassica oleracea 43.22 2.00e-24 106.00
IUUC-Bra-017442 Brassica rapa 43.22 1.00e-24 107.00
IUUC-Cel-018697 Caenorhabditis elegans 46.76 5.00e-37 148.00
IUUC-Cja-018963 Callithrix jacchus 84.68 0.00e+00 644.00
IUUC-Cfa-020472 Canis familiaris 87.01 0.00e+00 657.00
IUUC-Cpo-022001 Cavia porcellus 87.01 0.00e+00 662.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 29.81 1.00e-30 126.00
IUUC-Csa-023959 Chlorocebus sabaeus 85.94 0.00e+00 635.00
IUUC-Cho-024389 Choloepus hoffmanni 54.29 3.00e-34 139.00
IUUC-Cin-025688 Ciona intestinalis 46.10 4.00e-99 354.00
IUUC-Cne-026904 Cryptococcus neoformans 33.33 7.00e-17 81.60
IUUC-Cme-027280 Cyanidioschyzon merolae 36.59 5.00e-19 87.80
IUUC-Dre-027913 Danio rerio 81.51 2.00e-169 588.00
IUUC-Dno-029672 Dasypus novemcinctus 87.27 0.00e+00 665.00
IUUC-Dor-030175 Dipodomys ordii 95.71 7.00e-87 313.00
IUUC-Dse-031375 Dothistroma septosporum 35.61 4.00e-24 105.00
IUUC-Dme-031736 Drosophila melanogaster 47.68 1.00e-94 339.00
IUUC-Ete-032343 Echinops telfairi 83.85 0.00e+00 634.00
IUUC-Eca-033926 Equus caballus 86.49 0.00e+00 655.00
IUUC-Eeu-034940 Erinaceus europaeus 83.38 0.00e+00 639.00
IUUC-Fca-035491 Felis catus 85.42 0.00e+00 653.00
IUUC-Fal-037508 Ficedula albicollis 91.15 0.00e+00 688.00
IUUC-Fox-037937 Fusarium oxysporum 33.59 5.00e-22 98.60
IUUC-Fso-038091 Fusarium solani 36.57 3.00e-25 109.00
IUUC-Gmo-039427 Gadus morhua 76.82 4.00e-164 570.00
IUUC-Ggr-039724 Gaeumannomyces graminis 39.39 3.00e-25 109.00
IUUC-Gga-040998 Gallus gallus 97.14 0.00e+00 761.00
IUUC-Gac-041356 Gasterosteus aculeatus 78.12 2.00e-180 624.00
IUUC-Gma-043566 Glycine max 38.10 2.00e-24 106.00
IUUC-Ggo-044967 Gorilla gorilla 85.94 0.00e+00 635.00
IUUC-Hsa-046686 Homo sapiens 85.94 0.00e+00 635.00
IUUC-Hvu-047430 Hordeum vulgare 35.83 2.00e-20 92.80
IUUC-Itr-047929 Ictidomys tridecemlineatus 96.37 1.00e-106 378.00
IUUC-Kpa-049287 Komagataella pastoris 29.88 3.00e-16 79.30
IUUC-Lch-050597 Latimeria chalumnae 83.64 0.00e+00 667.00
IUUC-Lpe-051090 Leersia perrieri 36.67 5.00e-20 91.70
IUUC-Loc-052399 Lepisosteus oculatus 80.67 2.00e-173 600.00
IUUC-Lma-053249 Leptosphaeria maculans 31.58 5.00e-14 72.40
IUUC-Laf-053766 Loxodonta africana 86.75 0.00e+00 660.00
IUUC-Mcc-055641 Macaca mulatta 85.94 0.00e+00 635.00
IUUC-Meu-055919 Macropus eugenii 87.54 2.00e-162 564.00
IUUC-Mor-056970 Magnaporthe oryzae 39.84 8.00e-25 108.00
IUUC-Mpo-057345 Magnaporthe poae 38.28 5.00e-23 101.00
IUUC-Mtr-058436 Medicago truncatula 38.10 1.00e-25 110.00
IUUC-Mla-059037 Melampsora laricipopulina 38.41 8.00e-26 111.00
IUUC-Mvi-060463 Microbotryum violaceum 31.08 8.00e-17 81.60
IUUC-Mmr-060915 Microcebus murinus 87.53 0.00e+00 654.00
IUUC-Mdo-062449 Monodelphis domestica 86.23 0.00e+00 643.00
IUUC-Mmu-063151 Mus musculus 84.64 0.00e+00 650.00
IUUC-Mac-065020 Musa acuminata 34.65 6.00e-23 101.00
IUUC-Mpu-066621 Mustela putorius furo 85.97 0.00e+00 658.00
IUUC-Mlu-067336 Myotis lucifugus 85.68 0.00e+00 645.00
IUUC-Nfi-068530 Neosartorya fischeri 38.76 1.00e-24 107.00
IUUC-Ncr-068785 Neurospora crassa 38.06 1.00e-25 111.00
IUUC-Nle-069972 Nomascus leucogenys 85.94 0.00e+00 635.00
IUUC-Opr-071150 Ochotona princeps 88.08 3.00e-73 268.00
IUUC-Ont-071366 Oreochromis niloticus 77.86 2.00e-178 617.00
IUUC-Oan-073290 Ornithorhynchus anatinus 93.81 8.00e-104 369.00
IUUC-Ocu-074351 Oryctolagus cuniculus 85.94 0.00e+00 659.00
IUUC-Oba-075338 Oryza barthii 26.24 2.00e-11 62.40
IUUC-Obr-076135 Oryza brachyantha 26.95 3.00e-28 118.00
IUUC-Ogl-077182 Oryza glaberrima 34.82 1.00e-16 80.10
IUUC-Ogu-078281 Oryza glumaepatula 27.32 2.00e-25 109.00
IUUC-Oin-079068 Oryza indica 34.82 3.00e-16 79.30
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.00
IUUC-Ome-081781 Oryza meridionalis 27.25 2.00e-23 103.00
IUUC-Oni-082517 Oryza nivara 26.63 4.00e-24 105.00
IUUC-Opu-084101 Oryza punctata 34.82 1.00e-16 80.50
IUUC-Oru-084556 Oryza rufipogon 35.40 2.00e-16 80.10
IUUC-Osa-086264 Oryza sativa 34.82 1.00e-16 80.10
IUUC-Ola-087252 Oryzias latipes 92.62 5.00e-69 252.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.91 6.00e-17 81.30
IUUC-Oga-088304 Otolemur garnettii 86.20 0.00e+00 659.00
IUUC-Oar-089734 Ovis aries 88.05 0.00e+00 669.00
IUUC-Ptr-091476 Pan troglodytes 85.94 0.00e+00 635.00
IUUC-Pan-092341 Papio anubis 85.94 0.00e+00 635.00
IUUC-Psi-093470 Pelodiscus sinensis 88.42 0.00e+00 658.00
IUUC-Pma-094143 Petromyzon marinus 66.12 1.00e-133 468.00
IUUC-Pno-095069 Phaeosphaeria nodorum 34.91 7.00e-14 71.60
IUUC-Ppa-095933 Physcomitrella patens 29.11 2.00e-40 159.00
IUUC-Pfo-096321 Poecilia formosa 79.43 3.00e-170 590.00
IUUC-Pab-098527 Pongo abelii 84.39 2.00e-160 558.00
IUUC-Pop-099323 Populus trichocarpa 27.12 5.00e-36 144.00
IUUC-Pca-101044 Procavia capensis 68.05 2.00e-138 484.00
IUUC-Ppe-101458 Prunus persica 41.18 1.00e-26 113.00
IUUC-Pva-103014 Pteropus vampyrus 76.12 6.00e-155 539.00
IUUC-Pgr-103615 Puccinia graminis 38.89 1.00e-21 97.80
IUUC-Ptt-103826 Puccinia triticina 39.60 3.00e-17 82.80
IUUC-Pte-104171 Pyrenophora teres 37.30 6.00e-22 98.60
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 9.00e-11 61.20
IUUC-Rno-105957 Rattus norvegicus 83.85 0.00e+00 644.00
IUUC-Sce-106262 Saccharomyces cerevisiae 26.98 8.00e-11 60.80
IUUC-Sha-107607 Sarcophilus harrisii 86.89 3.00e-169 587.00
IUUC-Spo-108175 Schizosaccharomyces pombe 29.63 2.30e-02 33.10
IUUC-Ssl-108672 Sclerotinia sclerotiorum 40.60 4.00e-28 119.00
IUUC-Smo-108973 Selaginella moellendorffii 37.61 8.00e-21 94.00
IUUC-Sly-111373 Solanum lycopersicum 38.10 1.00e-23 103.00
IUUC-Stu-112844 Solanum tuberosum 38.10 6.00e-23 101.00
IUUC-Sar-113653 Sorex araneus 76.44 3.00e-161 560.00
IUUC-Sbi-114390 Sorghum bicolor 34.17 8.00e-20 90.90
IUUC-Sre-115200 Sporisorium reilianum 42.48 8.00e-23 101.00
IUUC-Ssc-115888 Sus scrofa 96.37 2.00e-106 377.00
IUUC-Tgu-117506 Taeniopygia guttata 94.55 0.00e+00 707.00
IUUC-Tru-118063 Takifugu rubripes 78.24 7.00e-166 576.00
IUUC-Tsy-118851 Tarsius syrichta 69.52 1.00e-130 458.00
IUUC-Tni-120010 Tetraodon nigroviridis 78.81 3.00e-165 573.00
IUUC-Tca-121182 Theobroma cacao 42.06 1.00e-23 103.00
IUUC-Tre-122040 Trichoderma reesei 36.72 8.00e-23 101.00
IUUC-Tvi-122660 Trichoderma virens 39.55 4.00e-26 112.00
IUUC-Tae-124561 Triticum aestivum 35.83 2.00e-20 92.80
IUUC-Tur-126651 Triticum urartu 35.83 3.00e-20 92.00
IUUC-Tme-127184 Tuber melanosporum 46.43 1.00e-24 107.00
IUUC-Tbe-127894 Tupaia belangeri 78.82 6.00e-83 300.00
IUUC-Ttr-128264 Tursiops truncatus 83.12 0.00e+00 635.00
IUUC-Uma-129407 Ustilago maydis 32.84 2.00e-23 103.00
IUUC-Vda-130002 Verticillium dahliae 31.51 3.00e-17 82.80
IUUC-Vpa-130156 Vicugna pacos 88.05 1.00e-82 299.00
IUUC-Vvi-131479 Vitis vinifera 39.68 2.00e-24 105.00
IUUC-Xtr-132332 Xenopus tropicalis 80.15 1.00e-60 224.00
IUUC-Xma-133186 Xiphophorus maculatus 79.43 6.00e-172 596.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 3.00e-13 69.30
IUUC-Zma-135391 Zea mays 34.75 2.00e-19 89.40
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved